CAZyme Information: MGYG000002643_00663

Basic Information

• Species: Turicimonas sp900542195
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Turicimonas; Turicimonas sp900542195
• CAZyme ID: MGYG000002643_00663
• CAZy Family: GT8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
646	MGYG000002643_7|CGC1	76735.02	9.1618

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002643	2740903	MAG	China	Asia

• Gene Location: Start: 4474; End: 6414 Strand: +

Full Sequence      

MKDFNIDLVYLWVNGEDPHWQKKYRENSSQKFFGKNRFRDNSELRYSLRSVARNMSWVNK
IFIVTDEQKPSWLKDNSKIQFVDHKDIIEKDFLPCFNSEAIELNVYKIKGLSERFILASD
DLFVFRPVPKSFFFDSNGDPIHRLIKTPNLDNKVPRNLYYQNLLFTKSLLREKGYRFPED
VEPYHNFEPYKVSTIKKVHELFSERITTTIANKFRSSNSVQRFIYSLMDLPQDRNRLRTA
TEEESIYFSIADVEKVPDVLKTKRPFLFCINDDERSDQNSLAKFPQVLEALFPEKAIWEV
EVKLEITPFFESRNSICLVFAPDNNYCKYFSATLKSLISCSKQEFNYDIVVLHTDINDYS
RRLLNLELPKNFSLRFIDISTYLYTNFNVKDFNVRSYWSISTYFKCFIPLIFKNYERVLF
CDADLVFADDFTEFYFTDFERKLVVGILDTIAPNLVNHPHRVRELRDLKILSPDSTYFNA
GVILFNLNGIDRNKYQKTLKETLKLVLPFQDQDLLNFIFQHDVKLASPRFNFQNGVTIYN
PQYLHQVDPAYAECYLAAFENPAIIHYTGSIKPWHDPYQKLSFYFWKFAKQGPFYEQILS
DLMGKSPKQSNNKLKNFVREKSKVMFPLHSKRREMIKKTLKRIGLL

Enzyme Prediction     

No EC number prediction in MGYG000002643_00663.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	314	576	3.8e-49	0.8832684824902723

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04194	GT8_A4GalT_like	5.96e-56	318	576	3	248	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.
pfam11380	Stealth_CR2	1.05e-43	37	140	1	106	Stealth protein CR2, conserved region 2. Stealth_CR2 is the second of several highly conserved regions on stealth proteins in metazoa and bacteria. There are up to four CR regions on all member proteins. CR2 carries a well-conserved NDD sequence-motif. The domain is found in tandem with CR1, CR3 and CR4 on both potential metazoan hosts and pathogenic eubacterial species that are capsular polysaccharide phosphotransferases. The CR domains appear on eukaryotic proteins such as GNPTAB, N-acetylglucosamine-1-phosphotransferase subunits alpha/beta. Horizontal gene-transfer seems to have occurred between host and bacteria of these sequence-regions in order for the bacteria to evade detection by the host innate immune system.
pfam01501	Glyco_transf_8	5.74e-37	317	576	1	250	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.
COG1442	RfaJ	6.46e-30	314	598	1	269	Lipopolysaccharide biosynthesis protein, LPS:glycosyltransferase [Cell wall/membrane/envelope biogenesis].
cd00505	Glyco_transf_8	1.49e-17	319	575	5	245	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMK14500.1	6.02e-52	306	612	21	323
QIM10714.1	1.47e-47	6	375	3	378
ASQ29972.1	2.31e-41	293	599	293	606
AXL32980.1	1.26e-40	301	599	279	574
ASN92820.1	2.26e-40	301	599	279	574

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6U4B_A	2.85e-26	306	584	294	576	ChainA, WbbM protein [Klebsiella pneumoniae]
7DXI_A	1.72e-21	6	149	15	159	ChainA, FI02838p [Drosophila melanogaster],7DXI_B Chain B, FI02838p [Drosophila melanogaster]
7S05_A	2.06e-21	2	155	256	413	ChainA, N-acetylglucosamine-1-phosphotransferase subunits alpha/beta [Homo sapiens],7S05_B Chain B, N-acetylglucosamine-1-phosphotransferase subunits alpha/beta [Homo sapiens],7S06_A Chain A, N-acetylglucosamine-1-phosphotransferase subunits alpha/beta [Homo sapiens],7S06_B Chain B, N-acetylglucosamine-1-phosphotransferase subunits alpha/beta [Homo sapiens]
1SS9_A	2.07e-18	318	575	3	253	ChainA, alpha-1,4-galactosyl transferase [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q714U9	1.56e-41	6	279	61	350	Capsular polysaccharide phosphotransferase fcs1 OS=Haemophilus influenzae OX=727 GN=fcs1 PE=3 SV=1
Q84BK9	3.98e-38	3	294	54	360	Capsular polysaccharide phosphotransferase LcbA OS=Aeromonas hydrophila OX=644 GN=lcbA PE=3 SV=1
Q848R7	1.01e-36	3	294	54	360	Capsular polysaccharide phosphotransferase LcbA OS=Aeromonas hydrophila OX=644 GN=lcbA PE=3 SV=1
Q51151	5.16e-35	1	292	57	368	Capsular polysaccharide phosphotransferase OS=Neisseria meningitidis serogroup B OX=491 PE=3 SV=1
Q8KSB4	8.04e-35	1	220	60	289	Capsular polysaccharide phosphotransferase cps1A OS=Actinobacillus pleuropneumoniae OX=715 GN=cps1A PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002643_00663.