CAZyme Information: MGYG000002643_01303

Basic Information

• Species: Turicimonas sp900542195
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Turicimonas; Turicimonas sp900542195
• CAZyme ID: MGYG000002643_01303
• CAZy Family: GH8
• CAZyme Description: Endoglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
366	MGYG000002643_17|CGC1	41102.31	8.512

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002643	2740903	MAG	China	Asia

• Gene Location: Start: 18613; End: 19713 Strand: -

Full Sequence      

MKKKLVAALLMSLAVHLPAHAWDLWDEFKAVNVTPEGRVVDYSDAKLITTSEGQSYGMFF
ALVANDRESFDKIFAWSEKNLGPEQPAWWWGIPDGKKDGQGKILDTNNATDSDMWIAYCL
LEAARIWNEPAYETKAKAYMAKLKELVRDVPTVGKVLLPARVGFEEKGVVTINPSYYPPF
ILRRFAEYDPSWLPILEGLINAMIRCSPGGAAPDWAKFDSTGKLLEPEKMVGSYNAIRTY
LWAAITSPKDPLYAKLARHYAPMINAVKTLNVPPEEVNLGSMSFGPREVNAFGACFLPYV
SNDKSGAVIRTLLTNTKMQGDNYYRNVLTIFGLGFDYKNYAFDAKGRLYIPKDNMTVRVN
QPQNKP

Enzyme Prediction     

No EC number prediction in MGYG000002643_01303.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH8	22	335	5.8e-70	0.99375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11097	PRK11097	3.14e-124	1	348	3	364	cellulase.
COG3405	BcsZ	3.07e-67	1	345	5	353	Endo-1,4-beta-D-glucanase Y [Carbohydrate transport and metabolism].
pfam01270	Glyco_hydro_8	1.64e-48	21	338	3	321	Glycosyl hydrolases family 8.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANU67169.1	1.67e-273	1	366	1	366
QQQ96024.1	1.67e-273	1	366	1	366
QDA53874.1	3.68e-115	1	350	1	360
QQS88762.1	1.24e-113	19	354	25	365
QDA53782.1	1.96e-91	22	352	71	411

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QXQ_A	1.27e-78	19	348	1	335	Structureof the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_B Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_C Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_D Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12]
4Q2B_A	2.12e-75	19	348	1	339	Thecrystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_B The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_C The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_D The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_E The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_F The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440]
3QXF_A	2.53e-75	19	348	1	335	Structureof the bacterial cellulose synthase subunit Z [Escherichia coli K-12],3QXF_B Structure of the bacterial cellulose synthase subunit Z [Escherichia coli K-12],3QXF_C Structure of the bacterial cellulose synthase subunit Z [Escherichia coli K-12],3QXF_D Structure of the bacterial cellulose synthase subunit Z [Escherichia coli K-12]
7F81_A	1.26e-74	19	348	5	339	ChainA, Glucanase [Enterobacter sp. CJF-002],7F81_B Chain B, Glucanase [Enterobacter sp. CJF-002],7F81_C Chain C, Glucanase [Enterobacter sp. CJF-002],7F81_D Chain D, Glucanase [Enterobacter sp. CJF-002]
7F82_A	3.55e-74	19	348	5	339	ChainA, Glucanase [Enterobacter sp. CJF-002],7F82_B Chain B, Glucanase [Enterobacter sp. CJF-002],7F82_C Chain C, Glucanase [Enterobacter sp. CJF-002],7F82_D Chain D, Glucanase [Enterobacter sp. CJF-002]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8X5L9	5.77e-80	1	348	4	356	Endoglucanase OS=Escherichia coli O157:H7 OX=83334 GN=bcsZ PE=3 SV=1
P37651	1.82e-78	1	348	4	356	Endoglucanase OS=Escherichia coli (strain K12) OX=83333 GN=bcsZ PE=1 SV=1
Q8ZLB7	3.75e-78	6	348	9	357	Endoglucanase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bcsZ PE=3 SV=1
Q8Z289	1.49e-77	19	348	23	357	Endoglucanase OS=Salmonella typhi OX=90370 GN=bcsZ PE=3 SV=1
P58935	2.22e-64	6	348	15	371	Endoglucanase OS=Xanthomonas axonopodis pv. citri (strain 306) OX=190486 GN=bcsZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000387	0.998831	0.000235	0.000177	0.000177	0.000172

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002643_01303.