CAZyme Information: MGYG000002643_02025

Basic Information

• Species: Turicimonas sp900542195
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Turicimonas; Turicimonas sp900542195
• CAZyme ID: MGYG000002643_02025
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
161		17662.41	8.9666

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002643	2740903	MAG	China	Asia

• Gene Location: Start: 21324; End: 21809 Strand: +

Full Sequence      

MISLTHKIAPGLIGLLISTLQPVFADCFDIHGRNFGVAPDLLRAIALTESSGNPSALAGP
KCSQDIGLMQINSQWLSKWNLSKSELLSNACLNIEIGARILKDNLMRFDNPWEAVGAYNA
GCSRLKGQDCTNARQKYAWKVFKNLQSLDDKTREKLKAVAS

Enzyme Prediction     

No EC number prediction in MGYG000002643_02025.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	38	151	3.3e-21	0.8296296296296296

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13400	LT_IagB-like	2.42e-39	35	147	1	109	Escherichia coli invasion protein IagB and similar proteins. Lytic transglycosylase-like protein, similar to Escherichia coli invasion protein IagB. IagB is encoded within a pathogenicity island in Salmonella enterica and has been shown to degrade polymeric peptidoglycan. IagB-like invasion proteins are implicated in the invasion of eukaryotic host cells by bacteria. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Members of this family resemble the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
PRK15328	PRK15328	8.09e-30	12	155	6	149	type III secretion system invasion protein IagB.
pfam01464	SLT	3.51e-22	32	126	5	100	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
PRK13722	PRK13722	4.99e-19	26	143	21	140	lytic transglycosylase; Provisional
cd00254	LT-like	1.95e-16	39	121	1	81	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANU65299.1	7.08e-107	1	161	1	161
QQQ96454.1	1.06e-105	4	161	1	158
ABM41737.1	4.68e-32	25	161	19	164
AEB85147.1	1.02e-31	17	148	11	149
QBM28515.1	3.09e-31	25	161	12	157

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XP8_A	5.04e-12	26	105	2	86	Structureof EtgA D60N mutant [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P43018	4.46e-21	19	154	13	148	Invasion protein IagB OS=Salmonella typhi OX=90370 GN=iagB PE=3 SV=1
E1WAC2	8.86e-21	19	148	13	142	Invasion protein IagB OS=Salmonella typhimurium (strain SL1344) OX=216597 GN=iagB PE=3 SV=1
P0CL15	8.86e-21	19	148	13	142	Invasion protein IagB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=iagB PE=3 SV=1
Q07568	3.18e-19	25	143	18	136	Protein IpgF OS=Shigella flexneri OX=623 GN=ipgF PE=3 SV=1
P14499	1.86e-18	25	143	20	140	X polypeptide OS=Escherichia coli OX=562 GN=X PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000328	0.999032	0.000187	0.000147	0.000138	0.000136

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002643_02025.