CAZyme Information: MGYG000002646_00432

Basic Information

• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Veillonellaceae; Veillonella
• CAZyme ID: MGYG000002646_00432
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
382	MGYG000002646_4|CGC1	41773.95	5.5969

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002646	1639033	MAG	China	Asia

• Gene Location: Start: 64125; End: 65273 Strand: -

Full Sequence      

MLRRIVAATMIGALALTSGCAFHNPFAKKAEPVTYEAVVQSELSPEEKVDKLVANMSDAD
KVGQLLMIGIHGTTLNDDAKFMLNEYRVGGIILFDRNMESKEQVKTLITDINKAGKSAGL
TPLFIGIDQEGGAVARMEDKLIKVPPAEELGQGSVDHAANLAKQVGTELKDLGFNINFAP
DADLGLTYGRSYSTNPDQVVKFAGAVGKAYDESGLWYSYKHFPGIGKTDVDLHADTSVVP
VSKDALLAEDTKVFVDLIKQSKPNTYMIMVSHAMYPQIDPNHPSSLSKKIITDWLRKDMG
YNGVVVTDDMDMGALAKHYTFGDMAVQSIQAGSDILLVCHEYEHMQEAYNGLMKAVKDGT
IPKERLDESVKRILLMKMSHGL

Enzyme Prediction     

No EC number prediction in MGYG000002646_00432.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	121	338	7.7e-44	0.9583333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	1.58e-76	56	382	1	317	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	4.27e-69	60	374	4	314	Glycosyl hydrolase family 3 N terminal domain.
PRK05337	PRK05337	1.33e-52	66	341	4	282	beta-hexosaminidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARG00121.1	4.59e-270	1	382	1	382
QQB17095.1	1.84e-246	1	379	1	379
ACZ25449.1	1.84e-246	1	379	1	379
SNV02550.1	1.84e-246	1	379	1	379
VEG94458.1	1.11e-245	1	382	1	382

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6K5J_A	4.52e-64	61	382	16	342	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
4ZM6_A	4.65e-43	53	377	3	337	Aunique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
3BMX_A	4.93e-43	50	382	36	398	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	1.89e-42	50	382	10	372	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	2.56e-42	50	382	40	402	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48823	4.72e-43	73	377	49	380	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
P40406	2.70e-42	50	382	36	398	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
Q0AF74	1.00e-39	66	352	6	296	Beta-hexosaminidase OS=Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57) OX=335283 GN=nagZ PE=3 SV=1
B2FPW9	2.94e-38	65	340	1	279	Beta-hexosaminidase OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=nagZ PE=3 SV=1
B4SRK3	2.94e-38	65	340	1	279	Beta-hexosaminidase OS=Stenotrophomonas maltophilia (strain R551-3) OX=391008 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000042	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002646_00432.