CAZyme Information: MGYG000002649_00438

Basic Information

• Species: CAAHEQ01 sp900772625
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; RF32; UBA3637; CAAHEQ01; CAAHEQ01 sp900772625
• CAZyme ID: MGYG000002649_00438
• CAZy Family: GT35
• CAZyme Description: Maltodextrin phosphorylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
458		53106.04	6.3059

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002649	1168434	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 47; End: 1423 Strand: -

Full Sequence      

MHRPDLKKLTPEVIAYHIELHMKYTLCKQMKEATKEHLFTALALAIRDWCIDQMFETAAR
HSKKDPKRVYYLSMEYLIGRMLENNLHNFGIYDLLDKVKLDNPIPLREVLDAEYDPALGN
GGLGRLAACFLDSMATLGLPGYGYGINYQFGLFRQRFENGYQKESADSWIERDSPWQIER
SDRSCYIPIRGRIHYDERDGVRYPRWVDADHIMAIPYDMPIVGYGGKTVNYLRLFSAKAT
NALNLQVFNTGGYVDAVENNIKTETISKVLYPSDSFEEGRKLRLIQQYFFVAAAINDILR
RFLEDHDDLHELPEKVVIQLNDTHPTLAIVELMRILMDVHGFTFEDALDVVSKTMAYTNH
TLLPEALEKWDVSLFEENLPRHLLIIYDINEWLMKKVRDQYPGDVAKLSRMSIIEEGEKK
KVRMAHLAIAGSFSVNGVARLHSELIKTRLVPDFYDLW

Enzyme Prediction     

EC	2.4.1.1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT35	104	458	7.2e-137	0.4896142433234421

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02093	P_ylase	0.0	18	458	1	441	glycogen/starch/alpha-glucan phosphorylases. This family consists of phosphorylases. Members use phosphate to break alpha 1,4 linkages between pairs of glucose residues at the end of long glucose polymers, releasing alpha-D-glucose 1-phosphate. The nomenclature convention is to preface the name according to the natural substrate, as in glycogen phosphorylase, starch phosphorylase, maltodextrin phosphorylase, etc. Name differences among these substrates reflect differences in patterns of branching with alpha 1,6 linkages. Members include allosterically regulated and unregulated forms. A related family, TIGR02094, contains examples known to act well on particularly small alpha 1,4 glucans, as may be found after import from exogenous sources. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
cd04300	GT35_Glycogen_Phosphorylase	0.0	18	458	4	442	glycogen phosphorylase and similar proteins. This is a family of oligosaccharide phosphorylases. It includes yeast and mammalian glycogen phosphorylases, plant starch/glucan phosphorylase, as well as the maltodextrin phosphorylases of bacteria. The members of this family catalyze the breakdown of oligosaccharides into glucose-1-phosphate units. They are important allosteric enzymes in carbohydrate metabolism. The allosteric control mechanisms of yeast and mammalian members of this family are different from that of bacterial members. The members of this family belong to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
pfam00343	Phosphorylase	7.04e-180	106	458	8	309	Carbohydrate phosphorylase. The members of this family catalyze the formation of glucose 1-phosphate from one of the following polyglucoses; glycogen, starch, glucan or maltodextrin.
PRK14985	PRK14985	2.94e-148	52	458	44	443	maltodextrin phosphorylase; Provisional
PRK14986	PRK14986	1.50e-147	9	454	12	453	glycogen phosphorylase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXA36295.1	2.37e-167	10	458	36	486
QTD53897.1	5.18e-167	21	458	28	466
ALG69205.1	2.13e-166	18	458	13	454
AUI68363.1	2.13e-166	18	458	13	454
QBH11483.1	3.37e-166	3	458	2	458

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5IKO_A	1.19e-144	21	457	38	478	Crystalstructure of human brain glycogen phosphorylase [Homo sapiens],5IKP_A Crystal structure of human brain glycogen phosphorylase bound to AMP [Homo sapiens]
5OX0_A	3.08e-144	21	457	35	475	GlycogenPhosphorylase in complex with CK898 [Oryctolagus cuniculus]
7P7D_A	4.34e-144	21	457	28	468	ChainA, Glycogen phosphorylase, muscle form [Oryctolagus cuniculus]
3ZCP_A	4.34e-144	21	457	35	475	Rabbitmuscle glycogen phosphorylase b in complex with N- cyclohexancarbonyl-N-beta-D-glucopyranosyl urea determined at 1.83 A resolution [Oryctolagus cuniculus]
2GJ4_A	5.22e-144	21	457	23	463	Structureof rabbit muscle glycogen phosphorylase in complex with ligand [Oryctolagus cuniculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q3B7M9	3.84e-145	21	457	35	475	Glycogen phosphorylase, brain form OS=Bos taurus OX=9913 GN=PYGB PE=2 SV=3
O18751	1.48e-144	21	457	35	475	Glycogen phosphorylase, muscle form OS=Ovis aries OX=9940 GN=PYGM PE=2 SV=3
P79334	1.48e-144	21	457	35	475	Glycogen phosphorylase, muscle form OS=Bos taurus OX=9913 GN=PYGM PE=1 SV=3
Q5MIB6	1.52e-144	21	457	35	475	Glycogen phosphorylase, brain form OS=Ovis aries OX=9940 GN=PYGB PE=2 SV=3
P11216	6.01e-144	21	457	35	475	Glycogen phosphorylase, brain form OS=Homo sapiens OX=9606 GN=PYGB PE=1 SV=5

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000103	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002649_00438.