CAZyme Information: MGYG000002650_00046

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA11452
• CAZyme ID: MGYG000002650_00046
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
489		55557.79	6.4976

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002650	3040804	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 11171; End: 12640 Strand: +

Full Sequence      

MNIVWATSESVPFAKTGGLADVSASLPAALAERGHQVSVIMPYYPQQFARLHLEFDGRHD
LLGVPFGGGTEWAAVRYKEIAPNLTYYFIEYNKYFDRATLYDWNGWEYPDNAQRFIFFSR
AAMQCVLAMKLTPDILHLNDWHSALCAVYLRSSLYNELDAFRRCRSVMTIHNIGYQGVFD
KGNIYWTGLGWDYFNYQCLEFYDRINLLKGGIMCADMVSTVSRTYAEEILSPDYGFSLDP
SLRHRASQGRLCGIPNGIDIQVWNPADDAKIPAQFTADNPAGKKQCKAALQKRFGLPVRP
DVPVFGVLSRLAYQKGLDVFAASLEDMLYHDDSQFVLIGSGDPGLQGHFQYLANRYPKRF
SVYIGYASDADSHLLEAGSDFFVMPSRYEPCGLNQMYSMRYGTLPVVRHTGGLADTVKNY
SPETLNESTGFVFWDLNPESLRNTIRWAADVYRQSPDAIRAMRRNGMTADFSWNHTAAQY
EKMYHDAHQ

Enzyme Prediction     

No EC number prediction in MGYG000002650_00046.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	2	485	7e-178	0.9957627118644068

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03791	GT5_Glycogen_synthase_DULL1-like	0.0	2	486	1	474	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
PRK00654	glgA	0.0	1	487	1	463	glycogen synthase GlgA.
COG0297	GlgA	0.0	1	485	1	476	Glycogen synthase [Carbohydrate transport and metabolism].
TIGR02095	glgA	0.0	1	485	1	471	glycogen/starch synthase, ADP-glucose type. This family consists of glycogen (or starch) synthases that use ADP-glucose (EC 2.4.1.21), rather than UDP-glucose (EC 2.4.1.11) as in animals, as the glucose donor. This enzyme is found in bacteria and plants. Whether the name given is glycogen synthase or starch synthase depends on context, and therefore on substrate. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
PRK14099	PRK14099	6.22e-122	8	486	11	478	glycogen synthase GlgA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABM04087.1	4.15e-221	1	487	1	487
QSZ41938.1	2.14e-144	1	484	4	482
BBG65910.1	6.07e-144	1	484	5	482
BAM01098.1	4.62e-138	8	487	4	477
ADR33932.1	1.20e-137	1	485	4	483

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4HLN_A	4.11e-103	2	484	126	622	Structureof barley starch synthase I in complex with maltooligosaccharide [Hordeum vulgare]
3D1J_A	3.46e-96	1	485	1	474	ChainA, Glycogen synthase [Escherichia coli]
2QZS_A	8.67e-96	1	485	1	474	CrystalStructure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSb) [Escherichia coli],2R4T_A Crystal Structure of Wild-type E.coli GS in Complex with ADP and Glucose(wtGSc) [Escherichia coli],2R4U_A Crystal Structure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSd) [Escherichia coli],3GUH_A Crystal Structure of Wild-type E.coli GS in complex with ADP and DGM [Escherichia coli K-12]
3COP_A	6.81e-95	1	485	1	474	ChainA, Glycogen synthase [Escherichia coli],3CX4_A Chain A, Glycogen synthase [Escherichia coli]
1RZU_A	8.20e-82	1	484	1	472	ChainA, Glycogen synthase 1 [Agrobacterium tumefaciens],1RZU_B Chain B, Glycogen synthase 1 [Agrobacterium tumefaciens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q74ED9	2.49e-129	1	484	4	482	Glycogen synthase 1 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=glgA1 PE=3 SV=1
A7H6L1	3.50e-128	1	484	1	469	Glycogen synthase OS=Anaeromyxobacter sp. (strain Fw109-5) OX=404589 GN=glgA PE=3 SV=1
Q1ILA0	6.59e-128	1	489	1	477	Glycogen synthase OS=Koribacter versatilis (strain Ellin345) OX=204669 GN=glgA PE=3 SV=1
Q39XS5	3.72e-126	1	484	4	482	Glycogen synthase 1 OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=glgA1 PE=3 SV=1
Q2IM81	1.80e-125	1	484	1	470	Glycogen synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) OX=290397 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002650_00046.