CAZyme Information: MGYG000002651_00390

Basic Information

• Species: Faecalibacterium sp900772565
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Faecalibacterium; Faecalibacterium sp900772565
• CAZyme ID: MGYG000002651_00390
• CAZy Family: PL12
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
645	MGYG000002651_4|CGC1	71894.64	6.2799

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002651	2281803	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 36578; End: 38515 Strand: +

Full Sequence      

MGVMLWTQDAAAVAAEIQTQCPASARNAIMRAEEICRREFLFRDHWEMEPTHKPVRFSGS
VQWNAVPFGDPEWTYALNRHTLLLNLAKAWCFTGEERFRTAFVELLTDWLDRVPHTPESE
RTTWRALEAGLRPENWLRAVELFGDALPAPLLERMNESLAEHGAFLVREHKAFHRLSNWG
AIQSHGLFLIGLWLNRKDWQTLALKRLTENLHNAVLPDGVQWEQSPMYHCEVLHAAADTL
LLTRRNGIQVPPALEETIHRMFRALAVWVTPKREILPQSDSDCIDAGDLLAQGALLFADP
ELTAAAEGPLCEETLWDFGADARTKLDALPKRRPAQPSQALDTSGNYMLRSGWDRDDTYI
HLHCGSLGGGHGHADLLHLDVWHHGEAVLADAGRYTYVEGAERAWFKSPAAHNTFRVDET
DFTRYRATWEWAEIARPLPTETHFTPQADLLRAGHLGYAAQGITAEREIVFLKPDLLIGV
DRIFAPEGTHHTVEQFFHFGSGTLEQDDASVLWQGKQTCAQLHWLAGQFAARSALPAAPL
YNLQIRTPVLGLKCHTKSTASLPFVLCLGGTCKVELLPVTDGNGRLLAADAVQAVRITRN
GQNVTVIFCHKTGAHDAALLCADGCAGHGSVLVFTPQSPDGLCLR

Enzyme Prediction     

No EC number prediction in MGYG000002651_00390.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL12	344	478	1.4e-38	0.9703703703703703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16889	Hepar_II_III_N	3.21e-28	62	301	86	340	Heparinase II/III N-terminus. This is the N-terminal domain of heparinase II/III proteins. It is a toroid-like domain.
pfam07940	Hepar_II_III	2.30e-26	333	515	1	183	Heparinase II/III-like protein. This family features sequences that are similar to a region of the Flavobacterium heparinum proteins heparinase II and heparinase III. The former is known to degrade heparin and heparin sulphate, whereas the latter predominantly degrades heparin sulphate. Both are secreted into the periplasmic space upon induction with heparin.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABX43379.1	1.05e-170	24	645	29	656
AEN95953.1	3.69e-133	6	634	15	660
QIX90196.1	1.18e-125	5	634	22	689
QQR04156.1	2.46e-125	5	634	22	691
ANU50362.1	2.46e-125	5	634	22	691

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JMD_A	1.67e-17	45	418	89	471	HeparinaseIII-BT4657 gene product, Methylated Lysines [Bacteroides thetaiotaomicron VPI-5482]
4MMH_A	8.72e-17	57	482	94	503	Crystalstructure of heparan sulfate lyase HepC from Pedobacter heparinus [Pedobacter heparinus]
4MMI_A	8.72e-17	57	482	94	503	Crystalstructure of heparan sulfate lyase HepC mutant from Pedobacter heparinus [Pedobacter heparinus]
4FNV_A	8.14e-15	40	424	118	521	CrystalStructure of Heparinase III [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q59289	4.91e-16	57	482	118	527	Heparin-sulfate lyase OS=Pedobacter heparinus (strain ATCC 13125 / DSM 2366 / CIP 104194 / JCM 7457 / NBRC 12017 / NCIMB 9290 / NRRL B-14731 / HIM 762-3) OX=485917 GN=hepC PE=1 SV=1
C7EXL6	1.85e-14	57	414	109	478	Heparin-sulfate lyase OS=Bacteroides stercoris OX=46506 GN=hepC PE=1 SV=1
Q89YR9	4.46e-14	40	424	118	521	Heparin-sulfate lyase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=hepC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.969208	0.030488	0.000179	0.000050	0.000028	0.000064

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002651_00390.