CAZyme Information: MGYG000002651_01823

Basic Information

• Species: Faecalibacterium sp900772565
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Faecalibacterium; Faecalibacterium sp900772565
• CAZyme ID: MGYG000002651_01823
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
321		34258.63	5.4212

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002651	2281803	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 4103; End: 5068 Strand: +

Full Sequence      

MLTINVAPDGSGQFTTISEAVLAVPYDCPAVIRIAPGIYREKLVCEKKDITLAGAGMDAT
RLVWNDGGKLPHPDGRPTHTFRSYTAFFSGEKLRVEDMTIENDAGPGAKVGQAIAAYVDS
ARAAFSRVRLLGNQDTLFCAPLPEKEREKDGFLGPRGLAPRRASAQYYHACEIAGDIDFI
FGGADALFEHCTLRTVDNGLAHSWVTAPSGAADGLGFVFWDCDFVSDCPAGSVYLGRPWR
PTGKTAVLDCRLGAHIAPEGFAGWNDRTDTALAGFAEAGSTGAGAGERPGWVQTLSAAEA
AALLRAARQKCRMETTERITE

Enzyme Prediction     

No EC number prediction in MGYG000002651_01823.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	4	303	1.6e-76	0.9652777777777778

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	7.63e-53	6	296	87	389	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
pfam01095	Pectinesterase	5.00e-49	6	286	4	267	Pectinesterase.
PLN02773	PLN02773	6.57e-46	4	295	7	282	pectinesterase
PLN02745	PLN02745	1.52e-37	6	285	289	551	Putative pectinesterase/pectinesterase inhibitor
PLN02682	PLN02682	2.18e-37	2	296	69	348	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXB27671.1	6.42e-237	1	321	1	321
CBL01447.1	6.42e-237	1	321	1	321
AXA81880.1	3.30e-183	1	315	1	315
CBK98674.1	2.22e-181	1	315	1	315
QIA44050.1	1.09e-178	1	312	1	312

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	2.13e-25	6	286	7	270	ChainA, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	5.60e-24	6	285	11	273	Pectinmethylesterase from Carrot [Daucus carota]
3UW0_A	6.47e-22	4	242	35	272	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
2NSP_A	3.94e-17	14	256	18	276	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
1QJV_A	1.09e-13	14	256	18	276	ChainA, PECTIN METHYLESTERASE [Dickeya chrysanthemi],1QJV_B Chain B, PECTIN METHYLESTERASE [Dickeya chrysanthemi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	2.69e-36	4	300	7	287	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q43062	3.17e-28	6	265	211	454	Pectinesterase/pectinesterase inhibitor PPE8B OS=Prunus persica OX=3760 PE=2 SV=1
Q8VYZ3	3.65e-28	12	300	94	366	Probable pectinesterase 53 OS=Arabidopsis thaliana OX=3702 GN=PME53 PE=2 SV=1
Q8GXA1	1.70e-26	6	287	260	525	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3
Q9LXK7	1.90e-26	6	265	217	459	Probable pectinesterase/pectinesterase inhibitor 32 OS=Arabidopsis thaliana OX=3702 GN=PME32 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000071	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002651_01823.