CAZyme Information: MGYG000002652_00772

Basic Information

• Species: UBA4248 sp004554395
• Lineage: Bacteria; Myxococcota; Bradymonadia; UBA4248; UBA4248; UBA4248; UBA4248 sp004554395
• CAZyme ID: MGYG000002652_00772
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
371		39856.91	7.4196

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002652	3178465	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 33069; End: 34184 Strand: -

Full Sequence      

MGKVHKVLFAAGGTGGHVFPAIAVADAMKCADPNVDIAFVGAAHGNESTWVQKAGYRFVL
LDIDFIKGASFGRKMRNIFALPGCARRASKILRDEAPDLVIGSGGYVSGPLVAVASIKGI
PTAIMEQNAIPGLTNRILSRFVDKIYTSFENTINLPKKKIVCMGNPVRSASKREPHPIEW
QTSCTGSTIGEGDLRILVFGGSQGAMKLNTGVPKALATLPEDLQSRISVYHQAGKNKCDE
TTKAYEDAKVTAHITEFIDDMWSAYQWADLLICRAGATSLAEIMAAAKASILVPFPHAAH
NHQEKNADVMVERGAAVKVLDADVETAIAPIVEDLVANRDKIEKMERCAREKAHPEAAMD
IAKDCLSFGAE

Enzyme Prediction     

No EC number prediction in MGYG000002652_00772.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	196	357	2.8e-52	0.9872611464968153

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00726	murG	1.78e-131	6	368	3	354	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
cd03785	GT28_MurG	1.29e-126	6	363	1	349	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
TIGR01133	murG	7.90e-99	6	363	2	346	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0707	MurG	6.42e-98	6	367	2	353	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
pfam04101	Glyco_tran_28_C	4.62e-37	196	358	2	163	Glycosyltransferase family 28 C-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). Structural analysis suggests the C-terminal domain contains the UDP-GlcNAc binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEI68978.1	2.97e-84	6	368	3	357
ATB49745.1	2.97e-84	6	368	3	357
AKU91863.1	3.55e-84	6	368	2	356
AWV89528.1	5.67e-84	3	368	8	369
QED35993.1	8.77e-84	6	368	12	370

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3S2U_A	1.61e-60	6	366	4	352	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
1F0K_A	1.30e-54	2	364	4	349	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]
7D1I_A	3.04e-52	3	361	8	358	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D0T0	4.73e-84	6	368	3	357	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=murG PE=3 SV=1
Q2LR48	1.74e-81	6	368	4	358	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=murG PE=3 SV=1
B8J8E8	1.88e-80	6	368	2	356	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) OX=455488 GN=murG PE=3 SV=1
Q2IG27	2.66e-80	6	368	2	356	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) OX=290397 GN=murG PE=3 SV=1
B4UES1	5.29e-80	6	368	2	356	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Anaeromyxobacter sp. (strain K) OX=447217 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000077	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002652_00772.