CAZyme Information: MGYG000002653_00662

Basic Information

• Species: Prevotella sp002251295
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp002251295
• CAZyme ID: MGYG000002653_00662
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
583	MGYG000002653_8|CGC1	65121.18	6.6399

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002653	3045320	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 61966; End: 63717 Strand: +

Full Sequence      

MKHSVLMAAMAAALLFPATAKAQYPQITQEAKKLIDSLENKWQAHSDSAWAVAFPIVVKE
AQEGKPYVPWASRPYDLRQAKIPAFPGAEGGGMYTFGGRGGKVLTVTNLNDDGPGSFRWA
CEQGGARIVVFNVSGIIRLKSPIFVRAPYITIAGQTAPGEGVIIAGESFQVDTHDVIVRH
MRFRRGETLVWHREDSFGGNPVGNIMIDHCSCEWGLDENISFYRHMFDMKDGKPKRKVPT
VNVTIQNTISAKALDTWNHAFGSTIGGENATFMRNLWADNTGRNPSIGWGGVFNFVNNVV
YNWVHRTADGGEFTTMSNFINNYYKPGPLTPKNSPVGHRIVKSESRSVNLFPFKQFGRVY
ATGNIMEGYDEVTRNNWNGGIQTADKDGDIDATELALMRSNEPFEMPFVNIMGAEKAFDW
VLSNAGATIPSRDIVDQRICDEVRTGQAYFVEKYEKKVKDNPYGDMWGLHDKSKNEQGFF
KHRRLQQDSYKQGIITDPRQMGGYPEYKAWTPWVDTDGDGMPDEWEIANGLNPNDPSDAN
GDCNGDGYTNIEKYINGIDPKSKVDWRNLNNNYDTLAAKGKLM

Enzyme Prediction     

No EC number prediction in MGYG000002653_00662.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	134	324	1.3e-63	0.994535519125683

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam18884	TSP3_bac	4.00e-05	515	536	1	22	Bacterial TSP3 repeat. This entry contains a novel bacterial thrombospondin type 3 repeat which differs from the typical consensus by containing a glutamate in place of one of the calcium binding aspartate residues.
smart00656	Amb_all	3.73e-04	149	303	17	166	Amb_all domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS84828.1	0.0	1	583	1	578
QNT66944.1	0.0	8	583	9	581
QIM10099.1	0.0	11	579	20	584
QUT77855.1	1.35e-311	1	583	1	575
QNL37620.1	9.00e-311	2	583	3	579

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B8NQQ7	6.08e-49	82	562	20	417	Probable pectate lyase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyC PE=3 SV=1
A1DPF0	8.46e-48	82	562	21	418	Probable pectate lyase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyC PE=3 SV=1
B0XMA2	1.62e-47	82	562	21	418	Probable pectate lyase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyC PE=3 SV=1
Q4WL88	1.62e-47	82	562	21	418	Probable pectate lyase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyC PE=3 SV=1
Q2UB83	4.22e-47	82	562	20	417	Probable pectate lyase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=plyC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000267	0.999020	0.000197	0.000187	0.000159	0.000144

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002653_00662.