CAZyme Information: MGYG000002653_01420

Basic Information

• Species: Prevotella sp002251295
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp002251295
• CAZyme ID: MGYG000002653_01420
• CAZy Family: CE6
• CAZyme Description: Carbohydrate acetyl esterase/feruloyl esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
654		72934.09	7.1279

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002653	3045320	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 13366; End: 15330 Strand: +

Full Sequence      

MKRLKLIISMLLLMTLYVSASSADQTVLSAGVDPNFQIYLCLGQSNMEGNATPEACDRVG
VNPRFVSMNVFDDEKAGWHKFQWRTAVPPLVAPQTGLTPADYFGRRMVDFLPEEVRVGVV
MAAVGGASIDLFDKRLYSDYLKKQPDWMKNFARRYDGNPYACLIAAAREAMKQGVLKGIL
FHQGETNTADPTWPARVKTVYDDILADLGLQAVDVPLLMGEVVQTDQGGHCGSHNAIIDD
IAKTIPTAHVISSKDCPQRGDGLHFTAEGYRILGKRYADVMLQLLGAPKQMHASAQKGSL
AENAIEGNEFPRIDAQHRAYFRLHAPEARDVKVDICGKKYPMLRDSNGEWYGVTDPLVVG
FHYYVFNVDGVSVTDPACDTYFGCHRLMSGLDVPEGDEGNYYHPQQGVAQGQVRSCTYFA
ASQGKFRRAMVYTPAEYERNKSKRYPVLYLQHGMGEDETGWSHQGHMNHILDNLIATGEC
VPMIVVMESGDVKAPFVPKRGATPDASRNGYGASFYQVLNDDLIPMIDKTFRTKTDRESR
AMAGLSWGGFQSFNTVLTHLDRFAYLGTFSGAIFGVDVKTCHNGVFADADRFNKQMKYMF
MGCGTEENFGTGKMVNDLKALGINVTYYESKGTAHEWLTWRRCLRQFVPHLFKK

Enzyme Prediction     

EC	3.1.1.72

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	423	650	9e-56	0.960352422907489
CE6	99	209	5.2e-29	0.9797979797979798

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03629	SASA	3.50e-41	35	283	1	226	Carbohydrate esterase, sialic acid-specific acetylesterase. The catalytic triad of this esterase enzyme comprises residues Ser127, His403 and Asp391 in UniProtKB:P70665.
cd02858	E_set_Esterase_N	3.36e-35	317	394	1	78	N-terminal Early set domain associated with the catalytic domain of esterase. E or "early" set domains are associated with the catalytic domain of esterase at the N-terminal end. Esterases catalyze the hydrolysis of organic esters to release an alcohol or thiol and acid. The term esterase can be applied to enzymes that hydrolyze carboxylate, phosphate and sulphate esters, but is more often restricted to the first class of substrate. The N-terminal domain of esterase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
COG2382	Fes	3.59e-23	427	654	82	298	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
pfam00756	Esterase	1.00e-14	427	571	8	143	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG2819	YbbA	7.93e-13	424	573	20	172	Predicted hydrolase of the alpha/beta superfamily [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNT67597.1	0.0	1	653	1	635
ALJ48336.1	4.53e-287	33	653	21	637
QRQ55180.1	4.53e-287	33	653	21	637
SCV07744.1	4.53e-287	33	653	21	637
QDH54067.1	9.12e-287	33	653	21	637

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7B5V_A	1.47e-107	295	653	24	386	ChainA, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B5V_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_A Chain A, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836]
6MOT_A	8.58e-105	302	653	10	359	ChainA, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393]
6MOU_A	1.75e-104	302	653	31	380	ChainA, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393],6MOU_B Chain B, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393]
6NE9_A	3.86e-83	307	653	38	382	ChainA, Isoamylase protein [Bacteroides intestinalis],6NE9_B Chain B, Isoamylase protein [Bacteroides intestinalis]
6RZO_A	1.40e-81	307	653	13	344	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D5EXZ4	1.42e-253	33	654	43	671	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
D5EY13	3.87e-68	307	653	391	726	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1
P31471	6.98e-37	312	653	42	389	Uncharacterized protein YieL OS=Escherichia coli (strain K12) OX=83333 GN=yieL PE=4 SV=3
P10478	3.66e-33	389	648	27	273	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
P0C1D6	1.59e-06	434	571	127	251	Protein PS1 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=csp1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000395	0.998824	0.000200	0.000196	0.000175	0.000168

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002653_01420.