CAZyme Information: MGYG000002653_01716

Basic Information

• Species: Prevotella sp002251295
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp002251295
• CAZyme ID: MGYG000002653_01716
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
318	MGYG000002653_30|CGC1	36236.12	7.523

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002653	3045320	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 27570; End: 28526 Strand: -

Full Sequence      

MICALCAVVDMEAKENFDNPDTIVVARDGTGRFRNVAEAIEVCRAFMDYHKVIYVKKGIY
KEKLTVPQWLTNIEICGEDRDNTIITWDDHANVYLPEIGKGMGTFRTYTLRIGGSHITLK
NITVENNSARLGQAVALHTEGDCLLFVNCRFLGHQDTIYTGNANTRLYFSGCYIEGTTDF
IFGPSTAWFENCDIYCKANSYITAASTPKEVAYGYIFNNCRITTAPDVTKVYLGRPWRDY
GYTLFMNCQLPQQIRPEGWHHWREEAKQTARYMEYNNQGEGAATGKRATWSKQLTKKEAQ
KITVAKVFARNDNWTPLP

Enzyme Prediction     

No EC number prediction in MGYG000002653_01716.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	23	308	1.1e-97	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01095	Pectinesterase	5.84e-76	23	306	2	293	Pectinesterase.
PLN02773	PLN02773	2.87e-66	25	317	9	305	pectinesterase
PLN02217	PLN02217	2.62e-61	20	316	250	551	probable pectinesterase/pectinesterase inhibitor
PLN02990	PLN02990	9.85e-59	23	316	261	561	Probable pectinesterase/pectinesterase inhibitor
PLN02745	PLN02745	1.94e-58	23	304	287	575	Putative pectinesterase/pectinesterase inhibitor

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVJ81978.1	5.64e-169	13	316	19	322
ADE82952.1	5.64e-169	13	316	19	322
BCS84477.1	2.42e-159	1	316	7	323
QJR97878.1	2.66e-152	5	316	1	318
AGB28242.1	1.05e-150	1	316	7	323

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	1.70e-43	23	309	9	303	Pectinmethylesterase from Carrot [Daucus carota]
1XG2_A	4.11e-39	24	290	6	277	ChainA, Pectinesterase 1 [Solanum lycopersicum]
5C1E_A	7.44e-39	23	287	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	4.02e-38	23	287	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
2NSP_A	1.22e-29	33	316	18	339	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GX86	3.28e-51	20	316	254	555	Probable pectinesterase/pectinesterase inhibitor 21 OS=Arabidopsis thaliana OX=3702 GN=PME21 PE=2 SV=2
P41510	2.02e-50	22	305	272	564	Probable pectinesterase/pectinesterase inhibitor OS=Brassica napus OX=3708 GN=BP19 PE=2 SV=1
Q9LVQ0	5.05e-50	25	299	9	287	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q3E8Z8	1.60e-49	20	316	251	552	Putative pectinesterase/pectinesterase inhibitor 28 OS=Arabidopsis thaliana OX=3702 GN=PME28 PE=2 SV=1
Q43043	2.93e-49	25	314	61	359	Pectinesterase OS=Petunia integrifolia OX=4103 GN=PPE1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000087	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002653_01716.