CAZyme Information: MGYG000002657_00397

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-95
• CAZyme ID: MGYG000002657_00397
• CAZy Family: GT11
• CAZyme Description: O-antigen biosynthesis glycosyltransferase WbnK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
300	MGYG000002657_5|CGC2	35826.46	5.1436

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002657	2838774	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 55612; End: 56514 Strand: +

Full Sequence      

MDIIRMEGGLGNQLFQYALYRQLQFMGRTVKMDVTTEYGREHDRQHMLWTLGASYEVATQ
EEINELTDGFMDLPSRIRRKLFGRKTKKYEEQSQNFDPLVLEKTPVYLTGYFQSDCYFRD
VVEELRQELHFSEHIWDHISTDLKRRLQEYEQQICSLQAVSLHIRRGDYLEHPEIYGVSC
TKEYYDTAIQYIKEYCPDAHFFVFTNDVSWVRTWLEEKASDEFTLIEGTTEENGYLDMML
MSKCRHHIMANSSFSWWGAWLNSYKQKIITAPTPWFGDRDCRDIYTKEMIRISPDGEVCR

Enzyme Prediction     

No EC number prediction in MGYG000002657_00397.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT11	3	290	3.5e-66	0.9818840579710145

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11301	Fut1_Fut2_like	3.62e-61	1	280	1	260	Alpha-1,2-fucosyltransferase. Alpha-1,2-fucosyltransferases (Fut1, Fut2) catalyze the transfer of alpha-L-fucose to the terminal beta-D-galactose residue of glycoconjugates via an alpha-1,2-linkage, generating carbohydrate structures that exhibit H-antigenicity for blood-group carbohydrates. These structures also act as ligands for morphogenesis, the adhesion of microbes, and metastasizing cancer cells. Fut1 is responsible for producing the H antigen on red blood cells. Fut2 is expressed in epithelia of secretory tissues, and individuals termed "secretors" have at least one functional copy of the gene; they secrete H antigen which is further processed into A and/or B antigens depending on the ABO genotype. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.
pfam01531	Glyco_transf_11	4.59e-22	8	262	8	266	Glycosyl transferase family 11. This family contains several fucosyl transferase enzymes.
cd11296	O-FucT_like	0.002	116	257	40	196	GDP-fucose protein O-fucosyltransferase and related proteins. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOZ97425.1	6.80e-77	1	293	1	289
ADL35260.1	2.19e-75	1	293	1	289
SNX52916.1	5.00e-59	1	292	1	287
QUO20851.1	5.83e-54	1	272	1	262
AXE16328.1	3.45e-53	1	292	1	287

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q58YV9	2.87e-30	6	292	5	302	O-antigen biosynthesis glycosyltransferase WbnK OS=Escherichia coli OX=562 GN=wbnK PE=1 SV=1
Q866F1	1.27e-08	108	261	165	318	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Saimiri sciureus OX=9521 GN=FUT1 PE=3 SV=1
Q866F0	1.27e-08	108	261	165	318	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Saimiri boliviensis boliviensis OX=39432 GN=FUT1 PE=3 SV=1
Q866E8	2.29e-08	108	261	165	318	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Sapajus apella OX=9515 GN=FUT1 PE=3 SV=1
Q866D2	4.09e-08	108	261	164	317	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Leontocebus fuscicollis OX=9487 GN=FUT1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002657_00397.