CAZyme Information: MGYG000002662_00459

Basic Information

• Species: UBA3388 sp900546465
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; P3; UBA3388; UBA3388 sp900546465
• CAZyme ID: MGYG000002662_00459
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
336	MGYG000002662_4|CGC1	38118.24	8.2203

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002662	2000155	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 93148; End: 94158 Strand: +

Full Sequence      

MTILVSRTDGIGDVVLTLPLAGVIKHYFAGVKVLFLGRTYTEAVVSMCEDVDEFLNWDEL
AKDENLGVKLLKTKQIDLVLHVFPNKEVAKLCKQAGIKFRVGTSHRIYNWLFCNKLVHFS
RRNSDEHEAVLNLKLLYPLTKEKNRITIENICDYVHVKAARVSSCADKLLENSRCFKLIL
HPKSKGSAREWGLHNFRLLIGALDKSKYRIFLCGTEEEGQRFREELLSETDENVYDLSGK
LSLEQYISLIADSDALVAASTGPLHIAAILNKHAIGLYPPIRPMNPERWQPIGENVKVFC
KDKICNTCRKTTYCSCMQSINPEEVAEYLGKLTNRA

Enzyme Prediction     

No EC number prediction in MGYG000002662_00459.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	69	313	7.8e-35	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0859	RfaF	8.89e-45	1	329	2	326	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03789	GT9_LPS_heptosyltransferase	8.52e-39	2	329	1	275	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
pfam01075	Glyco_transf_9	3.89e-23	69	312	6	240	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
PRK10916	PRK10916	9.97e-11	186	283	192	292	ADP-heptose--LPS heptosyltransferase RfaF.
PRK10964	PRK10964	1.61e-05	191	283	194	284	lipopolysaccharide heptosyltransferase RfaC.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHT67076.1	3.62e-104	2	327	6	328
QTD53942.1	3.11e-99	1	326	1	325
APJ04867.1	1.56e-93	3	331	9	340
QNP53849.1	1.43e-91	2	325	3	332
AHJ99225.1	2.03e-91	2	331	3	338

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P45042	9.01e-09	1	332	1	343	ADP-heptose--LPS heptosyltransferase 2 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=rfaF PE=3 SV=1
P37421	1.25e-06	165	299	171	305	ADP-heptose--LPS heptosyltransferase 2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaF PE=3 SV=1
P37692	5.29e-06	186	299	192	305	ADP-heptose--LPS heptosyltransferase 2 OS=Escherichia coli (strain K12) OX=83333 GN=rfaF PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000005	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002662_00459.