CAZyme Information: MGYG000002662_00843

Basic Information

• Species: UBA3388 sp900546465
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; P3; UBA3388; UBA3388 sp900546465
• CAZyme ID: MGYG000002662_00843
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
583		67694.5	5.6058

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002662	2000155	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 51235; End: 52986 Strand: +

Full Sequence      

MKRCITIILCLFASTYSQAQTDTMEKLKNRPYPQWFSDAKLGIFVHFGLYSVPSYSGKEQ
YAEWFYKGLISGDSLRINFQKDVFGKNFRYEDYKDLFKAELFDAEQWAELFRKSGARYVL
FTSKHHDGYCMYNSRYAQAWSSATTAPARDFCMELSREVRKKGLRMGMYYSLTEWTNPLY
RWTVDTTKSINEYVAKHLHPQFKEMVDKFLPDVIFSDGDWDFDYKTFGSEELVSYYYDKV
GKDAIVNNRWGKGFDHGYLTPEYSEAIKETNRPWAECRGLSRSFGLNRNADLSSYLTSEE
LIRHFVRLVAAGGGLTINVAPAADGSIPLLQQERLCDLGEWLELNGEAIYACSTFEKPNE
TYDAMALRYDEKIDFDWVRNAPAKGVPADNFTIHWHNEMIPEKTEKYKFYLEADDNAGLQ
IKDENGVEVFRLAAEKEMVQAEVKLKKNKKYFLELVYSENTEEALVKLFWESPSFEKQAV
SIPGRKWTGETDWEQSYVCFTVNNDNLYAIALEAVSTQLSFILENAPNEDMKVCFLSTNP
IYLDWKYNKATKKFTIDTSTLHPADVKSKGAYVFKLEGYMKNR

Enzyme Prediction     

No EC number prediction in MGYG000002662_00843.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	15	350	7.6e-92	0.930635838150289

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00812	Alpha_L_fucos	2.59e-110	25	361	12	349	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
pfam01120	Alpha_L_fucos	1.80e-109	17	347	3	333	Alpha-L-fucosidase.
COG3669	AfuC	2.43e-47	46	351	1	321	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
smart00758	PA14	5.17e-10	373	480	26	133	domain in bacterial beta-glucosidases other glycosidases, glycosyltransferases, proteases, amidases, yeast adhesins, and bacterial toxins.
pfam07691	PA14	1.17e-09	368	473	23	130	PA14 domain. This domain forms an insert in bacterial beta-glucosidases and is found in other glycosidases, glycosyltransferases, proteases, amidases, yeast adhesins, and bacterial toxins, including anthrax protective antigen (PA). The domain also occurs in a Dictyostelium prespore-cell-inducing factor Psi and in fibrocystin, the mammalian protein whose mutation leads to polycystic kidney and hepatic disease. The crystal structure of PA shows that this domain (named PA14 after its location in the PA20 pro-peptide) has a beta-barrel structure. The PA14 domain sequence suggests a binding function, rather than a catalytic role. The PA14 domain distribution is compatible with carbohydrate binding.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QZE15454.1	1.27e-178	1	581	1	609
QCX39739.1	2.05e-177	1	576	13	608
APS38947.1	5.47e-170	1	577	1	591
QIK54993.1	1.47e-169	6	576	9	598
QIK60426.1	2.95e-169	6	576	9	598

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1ODU_A	7.37e-71	25	372	13	379	CrystalStructure Of Thermotoga Maritima Alpha-Fucosidase In Complex With Fucose [Thermotoga maritima MSB8],1ODU_B Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase In Complex With Fucose [Thermotoga maritima MSB8]
2ZWY_A	8.62e-71	25	372	13	379	alpha-L-fucosidase[Thermotoga maritima],2ZWY_B alpha-L-fucosidase [Thermotoga maritima],2ZWZ_A alpha-L-fucosidase complexed with inhibitor, Core1 [Thermotoga maritima],2ZWZ_B alpha-L-fucosidase complexed with inhibitor, Core1 [Thermotoga maritima],2ZX5_A alpha-L-fucosidase complexed with inhibitor, F10 [Thermotoga maritima],2ZX5_B alpha-L-fucosidase complexed with inhibitor, F10 [Thermotoga maritima],2ZX6_A alpha-L-fucosidase complexed with inhibitor, F10-1C [Thermotoga maritima],2ZX6_B alpha-L-fucosidase complexed with inhibitor, F10-1C [Thermotoga maritima],2ZX7_A alpha-L-fucosidase complexed with inhibitor, F10-2C [Thermotoga maritima],2ZX7_B alpha-L-fucosidase complexed with inhibitor, F10-2C [Thermotoga maritima],2ZX8_A alpha-L-fucosidase complexed with inhibitor, F10-2C-O [Thermotoga maritima],2ZX8_B alpha-L-fucosidase complexed with inhibitor, F10-2C-O [Thermotoga maritima],2ZX9_A alpha-L-fucosidase complexed with inhibitor, B4 [Thermotoga maritima],2ZX9_B alpha-L-fucosidase complexed with inhibitor, B4 [Thermotoga maritima],2ZXA_A alpha-L-fucosidase complexed with inhibitor, FNJ-acetyl [Thermotoga maritima],2ZXA_B alpha-L-fucosidase complexed with inhibitor, FNJ-acetyl [Thermotoga maritima],2ZXB_A alpha-L-fucosidase complexed with inhibitor, ph-6FNJ [Thermotoga maritima],2ZXB_B alpha-L-fucosidase complexed with inhibitor, ph-6FNJ [Thermotoga maritima],2ZXD_A alpha-L-fucosidase complexed with inhibitor, iso-6FNJ [Thermotoga maritima],2ZXD_B alpha-L-fucosidase complexed with inhibitor, iso-6FNJ [Thermotoga maritima]
1HL8_A	1.44e-70	25	372	13	379	CrystalStructure Of Thermotoga Maritima Alpha-Fucosidase [Thermotoga maritima MSB8],1HL8_B Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase [Thermotoga maritima MSB8],1HL9_A Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase In Complex With A Mechanism Based Inhibitor [Thermotoga maritima MSB8],1HL9_B Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase In Complex With A Mechanism Based Inhibitor [Thermotoga maritima MSB8]
2WSP_A	7.76e-70	25	372	13	379	Thermotogamaritima alpha-L-fucosynthase, TmD224G, in complex with alpha-L-Fuc-(1-2)-beta-L-Fuc-N3 [Thermotoga maritima MSB8],2WSP_B Thermotoga maritima alpha-L-fucosynthase, TmD224G, in complex with alpha-L-Fuc-(1-2)-beta-L-Fuc-N3 [Thermotoga maritima MSB8]
7LJJ_A	2.32e-45	20	369	44	419	ChainA, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135],7LK7_A Chain A, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10901	1.01e-76	5	363	6	374	Alpha-L-fucosidase OS=Dictyostelium discoideum OX=44689 GN=alfA PE=3 SV=1
Q99KR8	1.22e-73	23	361	31	373	Plasma alpha-L-fucosidase OS=Mus musculus OX=10090 GN=Fuca2 PE=1 SV=1
C3YWU0	6.70e-73	5	392	3	401	Alpha-L-fucosidase OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_56888 PE=3 SV=2
Q9VTJ4	7.84e-73	27	361	41	379	Putative alpha-L-fucosidase OS=Drosophila melanogaster OX=7227 GN=Fuca PE=2 SV=2
Q5RFI5	3.93e-72	23	361	35	377	Plasma alpha-L-fucosidase OS=Pongo abelii OX=9601 GN=FUCA2 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000690	0.998330	0.000275	0.000262	0.000230	0.000207

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002662_00843.