CAZyme Information: MGYG000002662_00853

Basic Information

• Species: UBA3388 sp900546465
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; P3; UBA3388; UBA3388 sp900546465
• CAZyme ID: MGYG000002662_00853
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
247	MGYG000002662_9|CGC1	28210.23	9.1381

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002662	2000155	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 63523; End: 64266 Strand: -

Full Sequence      

MKRFPLAVLLLIYCSGLWSQSLNKATMDYIDKYKTIAQEQERIYKIPACITLAQGILESG
SGTSRLAVEANNHFGIKCHRDWEGEKFYKDDDRRNECFRVYASAEESYTDHSLFLKKKRY
ADLFELDIKDYKAWAKGLKRAGYATNPDYPQLLVNLIETYGLADMSSLPQNIAEVEKHET
EANKISAEELSDKGEAAMEETVKTRKRMSLAELIARRHAAKADKGKHVSGKRMTLKEKLS
GKRNKAE

Enzyme Prediction     

No EC number prediction in MGYG000002662_00853.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	36	162	2.7e-34	0.96875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	2.96e-32	20	162	37	184	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
NF038016	sporang_Gsm	1.34e-29	28	162	162	308	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
pfam01832	Glucosaminidase	3.85e-26	34	111	1	77	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
smart00047	LYZ2	5.78e-25	23	163	5	142	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
PRK12709	flgJ	1.57e-15	29	161	176	320	flagellar rod assembly protein/muramidase FlgJ; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEC61704.1	7.83e-61	23	187	52	221
AMQ00992.1	1.32e-59	26	189	46	199
QEK99355.1	1.30e-58	21	162	68	209
AEV32832.1	2.24e-58	3	162	2	159
QPH38130.1	2.31e-58	26	183	50	210

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VWO_A	8.98e-08	46	157	21	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	1.03e-07	46	157	22	144	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
5T1Q_A	1.90e-07	15	179	49	223	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
5DN5_A	3.10e-07	36	158	16	146	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	3.83e-07	36	158	16	146	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	4.51e-13	29	176	51	208	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9KQ15	1.13e-08	29	149	164	295	Peptidoglycan hydrolase FlgJ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=flgJ PE=3 SV=2
Q9X9J3	1.39e-08	29	149	163	294	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
P39046	1.74e-07	26	162	62	210	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1
Q2G222	7.44e-07	15	179	309	483	N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_02979 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001998	0.681489	0.315649	0.000321	0.000258	0.000264

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002662_00853.