CAZyme Information: MGYG000002662_01021

Basic Information

• Species: UBA3388 sp900546465
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; P3; UBA3388; UBA3388 sp900546465
• CAZyme ID: MGYG000002662_01021
• CAZy Family: GT9
• CAZyme Description: Lipopolysaccharide core heptosyltransferase RfaQ

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
332		37329.42	7.9182

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002662	2000155	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 30877; End: 31875 Strand: +

Full Sequence      

MEKILLIQTASIGDVILLTSLMEKLHDKFPNAAIDLVLKSPNEQLFANHPYIRDIWVWNK
KNGKYRNLFQIICGIREQGYDVVLCIQRFFSAGLMCVLSGAKHRIGFDKNPLSFFFTEAK
PHRIEKGVHEIDRNISLLSDIWCERAPKPHLYPSAKDFEKTAEYHRQATEYYCVSPCSLW
ETKTMSKEKWVELLSFMAKKNMEAKVFLLGSRDNAAQCEDIIRLCGNKNAENLCGKLSLL
ESAALMQGAKMNFVCDSAPLHLCSAVDAPVTAIFCSTTPDFGFGPLSSDSLVVQAEPQPA
CKPCGLHGAKKCKTGTFNCCTDIKMQQVFDRL

Enzyme Prediction     

No EC number prediction in MGYG000002662_01021.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	72	315	7.9e-43	0.9511111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03789	GT9_LPS_heptosyltransferase	1.39e-50	3	332	1	275	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0859	RfaF	9.37e-48	1	330	1	324	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01075	Glyco_transf_9	7.13e-27	75	304	8	236	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
PRK10422	PRK10422	1.18e-21	2	277	6	291	lipopolysaccharide core biosynthesis protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKZ12293.1	1.31e-108	3	328	9	330
CCG99523.1	5.88e-106	3	328	4	326
QHT65731.1	8.26e-104	2	328	4	325
QDK82049.1	1.43e-103	3	328	9	331
AYA38646.1	2.99e-103	2	328	8	330

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1PSW_A	6.90e-09	3	332	2	339	Structureof E. coli ADP-heptose lps heptosyltransferase II [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P25742	9.94e-15	13	277	5	279	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli (strain K12) OX=83333 GN=rfaQ PE=3 SV=2
P37421	4.91e-09	3	332	2	339	ADP-heptose--LPS heptosyltransferase 2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaF PE=3 SV=1
P37692	6.58e-09	3	332	2	339	ADP-heptose--LPS heptosyltransferase 2 OS=Escherichia coli (strain K12) OX=83333 GN=rfaF PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002662_01021.