CAZyme Information: MGYG000002663_01401

Basic Information

• Species: Prevotella sp900772835
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900772835
• CAZyme ID: MGYG000002663_01401
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
326	MGYG000002663_63|CGC1	36657.71	8.3102

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002663	2098573	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 326; End: 1306 Strand: -

Full Sequence      

MKKTLSTLLLAIAVITTAMAANKYDNPDTIFVARDGTAEFRNIDDAIEVCRAFMEYHKVI
FVKKGLYKEKLVVPSWLTNIEICGEDAENTIITYDDHANVFIPGTNRKMGTFRTYTVRVD
GNCITFKNITIENNAARLGQAVALHTQGDRLAFVNCRILGNQDTVYTGGINTRLYFKNCL
IEGTTDFIFGPSTAWFEGCIIKSRTNSYVTAASTPDGVKYGYVFNNCRLTACEGVDKVYL
GRPWRPYAHTLFMNCELGKHILPVGWHNWSNPANEKTARYCEYNNRGEGASPKTRAAWSR
QLSKNEAAQVTVANVFKQDYSWIPAE

Enzyme Prediction     

No EC number prediction in MGYG000002663_01401.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	30	317	1e-98	0.9895833333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01095	Pectinesterase	4.70e-71	32	314	4	293	Pectinesterase.
PLN02773	PLN02773	1.04e-69	32	309	9	289	pectinesterase
COG4677	PemB	1.24e-61	32	317	87	403	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02682	PLN02682	6.74e-60	20	307	61	352	pectinesterase family protein
PLN02432	PLN02432	9.75e-60	30	308	13	278	putative pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS84477.1	6.68e-173	20	325	19	324
QVJ81978.1	2.83e-164	1	324	1	322
ADE82952.1	2.83e-164	1	324	1	322
AGB28242.1	8.80e-159	8	326	7	325
QJR97878.1	1.05e-158	21	324	13	318

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	2.69e-39	30	325	9	310	Pectinmethylesterase from Carrot [Daucus carota]
5C1E_A	1.89e-37	32	295	13	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	1.01e-36	32	295	13	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
1XG2_A	5.79e-36	32	323	7	304	ChainA, Pectinesterase 1 [Solanum lycopersicum]
2NSP_A	1.02e-27	40	324	18	339	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P41510	4.53e-55	29	314	272	565	Probable pectinesterase/pectinesterase inhibitor OS=Brassica napus OX=3708 GN=BP19 PE=2 SV=1
Q42608	7.08e-55	29	314	259	552	Pectinesterase/pectinesterase inhibitor (Fragment) OS=Brassica campestris OX=3711 PE=2 SV=1
Q9LVQ0	1.36e-52	32	323	9	305	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q5MFV6	1.91e-52	29	314	276	569	Probable pectinesterase/pectinesterase inhibitor VGDH2 OS=Arabidopsis thaliana OX=3702 GN=VGDH2 PE=2 SV=2
O80722	3.80e-49	32	314	279	569	Pectinesterase 4 OS=Arabidopsis thaliana OX=3702 GN=PME4 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000233	0.999139	0.000156	0.000156	0.000147	0.000138

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002663_01401.