CAZyme Information: MGYG000002663_01581

Basic Information

• Species: Prevotella sp900772835
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900772835
• CAZyme ID: MGYG000002663_01581
• CAZy Family: GH141
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
619		67942.58	6.6288

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002663	2098573	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 523; End: 2382 Strand: -

Full Sequence      

MAAIAAMTLMALPSTAGDIYVATHGNDNAPGTLAAPLRTPAAALKMAREWRRLHKPETQG
GIFIHISGGIYRLATPLFLRPEDSGTKLSPTVICGDKKQETVLSGGIALSGWRKGCTDTR
IPAQARSRVWVADAPMQGNRIVYCRQLWVNGTKATRAQQGEQGEMTRMNSFCTKTKTITI
PTPEEELGDAAQLEMTVHQRWAIAVLRVKGMRDLGNGLTEVSFHEPESELEFTHPWPQPV
IGGERGNSSFFLSNAAQLLDHPGEWFQDYPSGRIYYLPRDGEDMGSVDAVVPVLENLVTV
DGTRERTVHDVEFRNVTFAHSAWTRPLREGLVTLQGGFRMLDAYKLHEPGLPEKALLENQ
AWIARPEAAVSIRHAVGIDFTGCRFSHLAATALDYELAASASTVSGCSFADIGGNGMLIG
HFPDGGFETHVPFKPAVAADLCDSITITENEVADAANEDWGCVGIGAGYVSNICISHNDV
HRLNYSGICVGWGWTPRESGMRRNRIIGNHVHDFARQLYDAGGIYTLSYQPDSEIRYNRI
DDLHNAPYATNDRAFYIYFDEATGGYSVTDNWCPEEKFGYNQPSAGMTVKNNGPKVSPKI
KAAAGISKKKEKQQKNNTR

Enzyme Prediction     

No EC number prediction in MGYG000002663_01581.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH141	18	577	1.3e-185	0.9962049335863378

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13229	Beta_helix	4.82e-11	399	542	8	112	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam13229	Beta_helix	5.65e-05	368	513	1	136	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
cd00250	CAS_like	0.004	219	329	100	208	Clavaminic acid synthetase (CAS) -like; CAS is a trifunctional Fe(II)/ 2-oxoglutarate (2OG) oxygenase carrying out three reactions in the biosynthesis of clavulanic acid, an inhibitor of class A serine beta-lactamases. In general, Fe(II)-2OG oxygenases catalyze a hydroxylation reaction, which leads to the incorporation of an oxygen atom from dioxygen into a hydroxyl group and conversion of 2OG to succinate and CO2

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD42515.1	2.21e-274	4	597	8	603
QUT37927.1	6.19e-263	16	605	12	601
QUT70625.1	6.19e-263	16	605	12	601
QIU95460.1	1.68e-262	16	605	22	627
ALJ42576.1	7.15e-262	16	605	12	601

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MQP_A	4.77e-163	15	606	23	615	Glycosidehydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_B Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_C Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_D Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_E Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_F Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_G Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_H Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.003109	0.995740	0.000295	0.000313	0.000258	0.000257

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002663_01581.