CAZyme Information: MGYG000002667_00882

Basic Information

• Species: F23-B02 sp004556755
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; F23-B02; F23-B02 sp004556755
• CAZyme ID: MGYG000002667_00882
• CAZy Family: GT26
• CAZyme Description: N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
242		26541.02	8.3363

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002667	1809480	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 22529; End: 23257 Strand: +

Full Sequence      

MLGVGFDNLTREQTVNACMKLIEKHASSYMVTPNPEIVMASWDNEALKTAAENADLVISD
GIGVVKAAKILGTPLKERLPGIEICEAVIERLSDIGGSVFLLGAKPGVAEKAAENLKKKY
PGLVVCGTQDGYFKDSEPIIEAINAAKPDFLMVCLGAPKQELWMYDNASRLDVGLMGGLG
GSLDVFAGVTDRAPKIWQRLGLEWLHRCIKEPWRFKRIARLPLFMTKAVETRIKRTFNGH
KG

Enzyme Prediction     

No EC number prediction in MGYG000002667_00882.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT26	52	217	2.5e-65	0.9766081871345029

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03808	Glyco_tran_WecB	1.13e-75	54	218	1	168	Glycosyl transferase WecB/TagA/CpsF family.
cd06533	Glyco_transf_WecG_TagA	5.99e-75	52	217	2	170	The glycosyltransferase WecG/TagA superfamily contains Escherichia coli WecG, Bacillus subtilis TagA and related proteins. E. coli WecG is believed to be a UDP-N-acetyl-D-mannosaminuronic acid transferase, and is involved in enterobacterial common antigen (eca) synthesis. B. subtilis TagA plays a key role in the Wall Teichoic Acid (WTA) biosynthetic pathway, catalyzing the transfer of N-acetylmannosamine to the C4 hydroxyl of a membrane-anchored N-acetylglucosaminyl diphospholipid to make ManNAc-beta-(1,4)-GlcNAc-pp-undecaprenyl. This is the first committed step in this pathway. Also included in this group is Xanthomonas campestris pv. campestris GumM, a glycosyltransferase participating in the biosynthesis of the exopolysaccharide xanthan.
COG1922	WecG	3.08e-74	2	235	13	251	UDP-N-acetyl-D-mannosaminuronic acid transferase, WecB/TagA/CpsF family [Cell wall/membrane/envelope biogenesis].
TIGR00696	wecG_tagA_cpsF	2.48e-44	54	224	6	177	bacterial polymer biosynthesis proteins, WecB/TagA/CpsF family. The WecG member of this superfamily, believed to be UDP-N-acetyl-D-mannosaminuronic acid transferase, plays a role in enterobacterial common antigen (eca) synthesis in Escherichia coli. Another family member, the Bacillus subtilis TagA protein, is involved in the biosynthesis of the cell wall polymer poly(glycerol phosphate). The third family member, CpsF, CMP-N-acetylneuraminic acid synthetase has a role in the capsular polysaccharide biosynthesis pathway. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK03692	PRK03692	4.68e-39	30	221	38	231	putative UDP-N-acetyl-D-mannosaminuronic acid transferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNL45647.1	2.71e-85	1	225	5	229
QQR06640.1	8.61e-84	1	234	5	238
ANU40581.1	8.61e-84	1	234	5	238
QIA30002.1	1.22e-83	1	234	5	238
QBB66589.1	2.13e-82	1	235	5	239

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MPK_A	2.78e-56	1	229	6	236	ChainA, N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase [Thermoanaerobacter italicus Ab9],7MPK_B Chain B, N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase [Thermoanaerobacter italicus Ab9],7MPK_C Chain C, N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase [Thermoanaerobacter italicus Ab9],7N41_A Chain A, N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase [Thermoanaerobacter italicus Ab9],7N41_B Chain B, N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase [Thermoanaerobacter italicus Ab9],7N41_C Chain C, N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase [Thermoanaerobacter italicus Ab9]
5WB4_A	1.13e-40	1	188	6	195	Crystalstructure of the TarA wall teichoic acid glycosyltransferase [Thermoanaerobacter italicus Ab9],5WB4_B Crystal structure of the TarA wall teichoic acid glycosyltransferase [Thermoanaerobacter italicus Ab9],5WB4_C Crystal structure of the TarA wall teichoic acid glycosyltransferase [Thermoanaerobacter italicus Ab9],5WB4_D Crystal structure of the TarA wall teichoic acid glycosyltransferase [Thermoanaerobacter italicus Ab9],5WB4_E Crystal structure of the TarA wall teichoic acid glycosyltransferase [Thermoanaerobacter italicus Ab9],5WB4_F Crystal structure of the TarA wall teichoic acid glycosyltransferase [Thermoanaerobacter italicus Ab9],5WB4_G Crystal structure of the TarA wall teichoic acid glycosyltransferase [Thermoanaerobacter italicus Ab9],5WB4_H Crystal structure of the TarA wall teichoic acid glycosyltransferase [Thermoanaerobacter italicus Ab9]
5WFG_A	2.26e-40	1	188	6	195	Crystalstructure of the TarA wall teichoic acid glycosyltransferase bound to UDP [Thermoanaerobacter italicus Ab9],5WFG_B Crystal structure of the TarA wall teichoic acid glycosyltransferase bound to UDP [Thermoanaerobacter italicus Ab9],5WFG_C Crystal structure of the TarA wall teichoic acid glycosyltransferase bound to UDP [Thermoanaerobacter italicus Ab9],5WFG_D Crystal structure of the TarA wall teichoic acid glycosyltransferase bound to UDP [Thermoanaerobacter italicus Ab9],5WFG_E Crystal structure of the TarA wall teichoic acid glycosyltransferase bound to UDP [Thermoanaerobacter italicus Ab9],5WFG_F Crystal structure of the TarA wall teichoic acid glycosyltransferase bound to UDP [Thermoanaerobacter italicus Ab9]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8NXS7	8.16e-43	1	234	14	249	N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase OS=Staphylococcus aureus (strain MW2) OX=196620 GN=tarA PE=3 SV=1
Q6GBJ4	1.62e-42	1	234	14	249	N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=tarA PE=3 SV=1
Q6GJ34	1.62e-42	1	234	14	249	N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=tarA PE=3 SV=1
Q7A714	1.62e-42	1	234	14	249	N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase OS=Staphylococcus aureus (strain N315) OX=158879 GN=tarA PE=1 SV=1
Q5HI32	1.62e-42	1	234	14	249	N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase OS=Staphylococcus aureus (strain COL) OX=93062 GN=tarA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000030	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002667_00882.