CAZyme Information: MGYG000002668_00436

Basic Information

• Species: Prevotella sp900552965
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900552965
• CAZyme ID: MGYG000002668_00436
• CAZy Family: GH5
• CAZyme Description: Xyloglucan-specific endo-beta-1,4-glucanase BoGH5A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
518		56312.38	5.9093

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002668	2820424	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 12382; End: 13938 Strand: -

Full Sequence      

MKKIPSLSLMALPLILISLLLFASCGSDDDEDTPSVTGFTVTPTALQYSKAGGTQSVSAR
AAQTITASSDQTWCTVTVGQTTPTLKVTPIKVTVEENKTQEARTATVTVTAGKETKTVSV
MQEKGEAASPDPSPDPSGSIKYDAKEVAKLMSPGWNLGNTMEAGNNANSWKSVGITTETS
WQKTKTSKELISFIKAQGFKSIRIPCAWVMGHITDAADCTIDPAWMARVKEVVNYCVEAD
LFVVLNQHWDGGWLEHDGFTASADVALKKQQLSKIWTQIAQAFRDYDDHVIFAGLNEPGV
GGAYKDNGSNISDDKLASRLAEYEQTFIDAVRATGGNNEYRVLVVQGPETSIDKTVKHNY
IATLSDKHSGRLMMEVHFYDPYQFTMMDKDANWGKMWYYWGKGNYGTDSNRNAASNATEN
YVSGLMAKLKSAFVDKGIPVIIGEYGANQRFAIGKDALHDASIRSWYEAVTSYAIANGCI
PFAWDTNSGNGMSIIDRSAVKVSNSNMMLGITNGSKGN

Enzyme Prediction     

No EC number prediction in MGYG000002668_00436.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	178	487	7.7e-95	0.9891304347826086

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	5.79e-49	174	490	12	272	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	7.85e-19	149	498	49	376	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
cd14948	BACON	5.30e-18	39	123	2	83	Bacteroidetes-Associated Carbohydrate-binding (putative) Often N-terminal (BACON) domain. The BACON domain is found in diverse domain architectures and accociated with a wide variety of domains, including carbohydrate-active enzymes and proteases. It was named for its suggested function of carbohydrate binding; the latter was inferred from domain architectures, sequence conservation, and phyletic distribution. However, recent experimental data suggest that its primary function in Bacteroides ovatus endo-xyloglucanase BoGH5A is to distance the catalytic module from the cell surface and confer additional mobility to the catalytic domain for attack of the polysaccharide. No evidence for a direct role in carbohydrate binding could be found in that case. The large majority of BACON domains are found in Bacteroidetes.
pfam19190	BACON_2	2.84e-10	39	123	2	89	Viral BACON domain. This family represents a distinct class of BACON domains found in crAss-like phages, the most common viral family in the human gut, in which they are found in tail fiber genes. This suggests they may play a role in phage-host interactions.
pfam13004	BACON	1.44e-09	64	123	2	61	Putative binding domain, N-terminal. The BACON (Bacteroidetes-Associated Carbohydrate-binding Often N-terminal) domain is an all-beta domain found in diverse architectures, principally in combination with carbohydrate-active enzymes and proteases. These architectures suggest a carbohydrate-binding function which is also supported by the nature of BACON's few conserved amino-acids. The phyletic distribution of BACON and other data tentatively suggest that it may frequently function to bind mucin. Further work with the characterized structure of a member of glycoside hydrolase family 5 enzyme, Structure 3ZMR, has found no evidence for carbohydrate-binding for this domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNT65311.1	5.88e-115	140	514	31	422
ADB44000.1	1.91e-113	33	514	37	508
VEH16026.1	4.73e-106	1	514	28	601
BAU54049.1	5.74e-96	137	486	47	375
AYL95531.1	4.41e-94	1	486	1	463

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4W8A_A	1.53e-99	143	514	2	370	Crystalstructure of XEG5B, a GH5 xyloglucan-specific beta-1,4-glucanase from ruminal metagenomic library, in the native form [uncultured bacterium],4W8B_A Crystal structure of XEG5B, a GH5 xyloglucan-specific beta-1,4-glucanase from ruminal metagenomic library, in complex with XXLG [uncultured bacterium]
5OYC_A	1.83e-80	128	490	34	365	GH5endo-xyloglucanase from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],5OYC_B GH5 endo-xyloglucanase from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],5OYD_A GH5 endo-xyloglucanase from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],5OYD_B GH5 endo-xyloglucanase from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],5OYE_A GH5 endo-xyloglucanase from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],5OYE_B GH5 endo-xyloglucanase from Cellvibrio japonicus [Cellvibrio japonicus Ueda107]
6HA9_A	1.42e-79	128	490	34	365	Structureof an endo-Xyloglucanase from Cellvibrio japonicus complexed with XXXG(2F)-beta-DNP [Cellvibrio japonicus Ueda107],6HA9_B Structure of an endo-Xyloglucanase from Cellvibrio japonicus complexed with XXXG(2F)-beta-DNP [Cellvibrio japonicus Ueda107],6HAA_A Structure of a covalent complex of endo-Xyloglucanase from Cellvibrio japonicus after reacting with XXXG(2F)-beta-DNP [Cellvibrio japonicus Ueda107],6HAA_B Structure of a covalent complex of endo-Xyloglucanase from Cellvibrio japonicus after reacting with XXXG(2F)-beta-DNP [Cellvibrio japonicus Ueda107]
3ZMR_A	5.15e-59	90	514	58	465	Bacteroidesovatus GH5 xyloglucanase in complex with a XXXG heptasaccharide [Bacteroides ovatus],3ZMR_B Bacteroides ovatus GH5 xyloglucanase in complex with a XXXG heptasaccharide [Bacteroides ovatus]
6WQY_A	5.29e-54	146	491	26	351	ChainA, Cellulase [Phocaeicola salanitronis DSM 18170]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXT7	5.11e-58	90	514	93	500	Xyloglucan-specific endo-beta-1,4-glucanase BoGH5A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02653 PE=1 SV=1
P23660	8.40e-55	137	498	19	346	Endoglucanase A OS=Ruminococcus albus OX=1264 GN=celA PE=1 SV=1
P28621	3.96e-45	137	485	35	339	Endoglucanase B OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engB PE=3 SV=1
O08342	4.58e-45	144	514	40	398	Endoglucanase A OS=Paenibacillus barcinonensis OX=198119 GN=celA PE=1 SV=1
P17901	7.76e-45	143	491	46	372	Endoglucanase A OS=Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) OX=394503 GN=celCCA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000001	1.000075	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002668_00436.