CAZyme Information: MGYG000002668_01292

Basic Information

• Species: Prevotella sp900552965
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900552965
• CAZyme ID: MGYG000002668_01292
• CAZy Family: GH35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
774		87586.4	8.5042

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002668	2820424	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 525; End: 2849 Strand: +

Full Sequence      

MSRFTSFLFALLMAFVFTPASIAKSGDFKAGKNTFLINGKPIVIKAAEIHYPRIPREYWD
HRMKMCKALGMNAVCIYIFWNIHEQKEGQFDFTGNNDIAAFCRLAQKNDLYVIVRPGPYV
CAEWEMGGLPWWLLKIKDIRLREKDPYFMERVEIFEQKVAEQLAPLAIQNGGPIIMVQVE
NEYGSYGEDKPYISAIRDIVRKNWNKDIALFQCDWASNFTKNGLDDLLWTMNFGTGANID
AQFSKLKQLRPDSPLMCSEFWSGWFDKWGARHETRPAKAMTDGIEEMLRKGISFSLYMTH
GGTSFGHWAGANSPGYAPDVTSYDYDAPINEYGQATEKYHLLRSVLQRYSDEKLPKMPKA
PMPLISFPRVTLSEYAPLQCGIDSTAEGLHTFEEMNMGYGTMIYEVTLPATSKPSILTMD
AHDYAQVFIGGQYIGKLDRVKKEKSLQLPAIYAPTKAIIIVEGMGRINFGRAIKDYKGII
GNITLTTEDEVSTIAYQPRQWKSHTVPDTYEQALKAFRKASAFNPSIGYLRGYYRGYVNI
RKVGDTFINMESFGKGLVYVNGHALGRFWNIGPQQTLFLPGCWLKKGRNEIIVLDIAGSN
VAPTVFGQAHPELNKLNIKKNRLHDNPKYKFDFSTCQLAAEGQLKPGNGWQRVAFGKPVT
GRYLTIEVLSSHQDDGRVAIAELYALDAKGVRLSREVWSAKYADSEDVQEGNNTADKVFD
LQESTYWQTCKGASMPHRITIDLGAVQTITGIELLPRAEQGAPYSIKDYRIYIK

Enzyme Prediction     

No EC number prediction in MGYG000002668_01292.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	35	347	2.5e-119	0.993485342019544

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01301	Glyco_hydro_35	9.74e-165	34	346	1	315	Glycosyl hydrolases family 35.
PLN03059	PLN03059	2.22e-50	5	600	7	717	beta-galactosidase; Provisional
COG1874	GanA	4.56e-44	34	593	7	587	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
pfam02449	Glyco_hydro_42	3.06e-11	51	189	3	149	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.
pfam00754	F5_F8_type_C	4.84e-08	703	773	2	70	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNT66372.1	0.0	9	774	12	787
ADE83089.1	0.0	11	773	7	786
QVJ81893.1	0.0	11	773	7	786
AGB27610.1	0.0	16	773	17	796
BCS84536.1	0.0	10	773	13	778

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EON_A	3.65e-295	7	774	7	773	GalactanaseBT0290 [Bacteroides thetaiotaomicron VPI-5482]
3D3A_A	5.80e-239	24	604	4	581	Crystalstructure of a beta-galactosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4MAD_A	3.95e-143	33	596	22	578	ChainA, Beta-galactosidase [Niallia circulans],4MAD_B Chain B, Beta-galactosidase [Niallia circulans]
3WF3_A	5.93e-118	32	596	39	622	Crystalstructure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_B Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_C Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_D Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF4_A Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_B Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_C Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_D Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens]
3THC_A	6.04e-118	32	596	15	598	Crystalstructure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_B Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_C Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_D Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THD_A Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_B Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_C Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_D Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48982	4.43e-123	10	579	12	573	Beta-galactosidase OS=Xanthomonas manihotis OX=43353 GN=bga PE=1 SV=1
P16278	6.23e-117	32	596	38	621	Beta-galactosidase OS=Homo sapiens OX=9606 GN=GLB1 PE=1 SV=2
Q5R7P4	1.08e-113	32	596	38	621	Beta-galactosidase OS=Pongo abelii OX=9601 GN=GLB1 PE=2 SV=1
Q58D55	8.48e-113	32	596	37	620	Beta-galactosidase OS=Bos taurus OX=9913 GN=GLB1 PE=2 SV=1
Q8NCI6	1.19e-112	31	604	76	648	Beta-galactosidase-1-like protein 3 OS=Homo sapiens OX=9606 GN=GLB1L3 PE=2 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000242	0.999115	0.000151	0.000176	0.000158	0.000142

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002668_01292.