CAZyme Information: MGYG000002668_01657

Basic Information

• Species: Prevotella sp900552965
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900552965
• CAZyme ID: MGYG000002668_01657
• CAZy Family: PL4
• CAZyme Description: Rhamnogalacturonate lyase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
627		69386.07	8.4619

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002668	2820424	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 192; End: 2075 Strand: -

Full Sequence      

MTKRLLTTILTTLLTAIALQAAGFTNVKLTVSGMTVTMSNGKTTIKIGSNGRASSMKWGS
RELLDGSNGIYFDYTTAQGNKALSPSKLDIIKQTDEMCEVLYSATSGNTIFQQGYIMRND
IAGVYTYVIATGTATSASEPLKEVRVCTRLASDMLNGYVDYRMNGKIPTNAEMAEAEKNQ
IQDATYYLSDGSVYTKYNWANFIERDTVHGVWNNNSYGVWNIPVSYEWLNGACDRQELMV
HATSKSPITIQMLQGEHLGGAALVLDEGEKKLFGPFLIYANYSTSPLANAKRIALEQQEK
WPFQWFDNDLYPKKRGNVTGHLNVTTGQRSDSVRIVLTQESGTELVTHTHGYNFWTTTDA
NGDFTLRNVRPGKYTLYAYAQAGDVTDELQMENITIGEGEQSIGTIDWTPRRYAKLHWMI
GENNRRSDGFHYSDTVRQYGLWTLPPADLTYVIGASKPQENWYYAQTKEGKWTVRFNLDE
IPRGNAVLTASLAGCTSAGSTVKVSVNGKEVDTWKPGVNDAAIYRSAVNAGRHWLFSTSF
SAAKLKKGTNIITFTMSGNGKNGGFLYDCVKLESGDVITSGISDIQTDIQQNDTRKNNKS
LCNLAGQRVTSSYRGVVVCEGGKKIKK

Enzyme Prediction     

No EC number prediction in MGYG000002668_01657.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL4	27	570	3.4e-127	0.9963702359346642

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10317	RGL4_C	1.89e-38	418	573	1	161	C-terminal domain of rhamnogalacturonan lyase, a family 4 polysaccharide lyase. The rhamnogalacturonan lyase of the polysaccharide lyase family 4 (RGL4) is involved in the degradation of RG (rhamnogalacturonan) type-I, an important pectic plant cell wall polysaccharide, by cleaving the alpha-1,4 glycoside bond between L-rhamnose and D-galacturonic acids in the backbone of RG type-I through a beta-elimination reaction. RGL4 consists of three domains, an N-terminal catalytic domain, a middle domain with a FNIII type fold and a C-terminal domain with a jelly roll fold. Both the middle and the C-terminal domain are putative carbohydrate binding modules. There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain (RG chain) through the beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
cd10320	RGL4_N	5.26e-34	27	288	1	264	N-terminal catalytic domain of rhamnogalacturonan lyase, a family 4 polysaccharide lyase. The rhamnogalacturonan lyase of the polysaccharide lyase family 4 (RGL4) is involved in the degradation of RG (rhamnogalacturonan) type-I, an important pectic plant cell wall polysaccharide, by cleaving the alpha-1,4 glycoside bond between L-rhamnose and D-galacturonic acids in the backbone of RG type-I through a beta-elimination reaction. RGL4 consists of three domains, an N-terminal catalytic domain, a middle domain with a FNIII type fold and a C-terminal domain with a jelly roll fold; the middle and C-terminal domains are both putative carbohydrate binding modules. There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain (RG chain) through the beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
pfam14683	CBM-like	4.13e-30	418	572	3	157	Polysaccharide lyase family 4, domain III. CBM-like is domain III of rhamnogalacturonan lyase (RG-lyase). The full-length protein specifically recognizes and cleaves alpha-1,4 glycosidic bonds between l-rhamnose and d-galacturonic acids in the backbone of rhamnogalacturonan-I, a major component of the plant cell wall polysaccharide, pectin. This domain possesses a jelly roll beta-sandwich fold structurally homologous to carbohydrate binding modules (CBMs), and it carries two sulfate ions and a hexa-coordinated calcium ion.
cd10316	RGL4_M	4.35e-16	314	406	1	92	Middle domain of rhamnogalacturonan lyase, a family 4 polysaccharide lyase. The rhamnogalacturonan lyase of the polysaccharide lyase family 4 (RGL4) is involved in the degradation of RG (rhamnogalacturonan) type-I, an important pectic plant cell wall polysaccharide, by cleaving the alpha-1,4 glycoside bond between L-rhamnose and D-galacturonic acids in the backbone of RG type-I through a beta-elimination reaction. RGL4 consists of three domains, an N-terminal catalytic domain, a middle domain with a FNIII type fold and a C-terminal domain with a jelly roll fold. Both the middle domain represented by this model and the C-terminal domain are putative carbohydrate binding modules. There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain (RG chain) through the beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
pfam14686	fn3_3	3.49e-09	349	400	22	71	Polysaccharide lyase family 4, domain II. FnIII-like is domain II of rhamnogalacturonan lyase (RG-lyase). The full-length protein specifically recognizes and cleaves alpha-1,4 glycosidic bonds between l-rhamnose and d-galacturonic acids in the backbone of rhamnogalacturonan-I, a major component of the plant cell wall polysaccharide, pectin. This domain displays an immunoglobulin-like or more specifically Fibronectin-III type fold and shows highest structural similarity to the C-terminal beta-sandwich subdomain of the pro-hormone/propeptide processing enzyme carboxypeptidase gp180 from duck. It serves to assist in producing the deep pocket, with domain III, into which the substrate fits.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBH93641.1	1.16e-113	27	581	48	588
BAV08848.1	3.59e-85	82	574	103	595
AUH06334.1	3.05e-82	71	572	86	576
AUH02012.1	3.05e-82	71	572	86	576
APC39134.1	8.12e-80	71	574	59	563

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8RJP2	3.49e-78	10	572	14	573	Rhamnogalacturonate lyase OS=Dickeya dadantii (strain 3937) OX=198628 GN=rhiE PE=1 SV=1
A5ABH4	4.23e-14	111	559	120	638	Probable rhamnogalacturonate lyase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rglB PE=3 SV=1
P78710	1.85e-10	129	572	118	538	Putative rhamnogalacturonase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=asd-1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000308	0.998943	0.000189	0.000178	0.000171	0.000157

TMHMM  Annotations     

start	end
5	24