CAZyme Information: MGYG000002669_00490

Basic Information

• Lineage: Bacteria; Eremiobacterota; Xenobia; Xenobiales; Xenobiaceae; Bruticola
• CAZyme ID: MGYG000002669_00490
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
318		35378.87	9.1555

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002669	1762651	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 2957; End: 3913 Strand: -

Full Sequence      

MNIIKDSFYNLCLSCSDQELSRRNNQKRRVFYWAVCSALLGIWSLAPVYADEIRAEVRTV
NGHKEIVYTNAANDSFMHGSSYPTYKGNRRSSSKKTVATTSKKNISAHSTLGTSSAAKAA
PQGKRRPDGTYEFAPPQYKVYEIKSKYSYGDEWSFATFDSAKRQPRLVSYYGWDPNDLQQ
KQRTWVEVDLNPIILKYAKIWGVDPLLVEIVICHESGFNPNAVSPAGAVGLMQLMPATAS
GLGVYDAFDVEQNIAGGTRYIASQLERFNSVPLALAAYNAGPGAVMQYGGVPPYSETQYY
VDTIYGEYLAGKRAREGR

Enzyme Prediction     

No EC number prediction in MGYG000002669_00490.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	205	310	5.1e-31	0.7925925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00254	LT-like	1.89e-43	205	308	1	110	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	3.43e-39	192	301	8	139	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16896	LT_Slt70-like	5.74e-36	193	302	7	138	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13403	MLTF-like	4.48e-34	194	287	1	101	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	2.31e-33	194	290	1	104	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHS22538.1	8.37e-40	160	310	55	206
ASS92357.1	1.53e-39	179	310	39	168
AEE96658.1	9.36e-39	189	304	88	203
BAB06571.1	9.52e-39	163	309	73	230
ARK31455.1	2.46e-38	188	309	93	215

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	3.70e-11	152	304	366	548	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	3.71e-11	152	304	370	552	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	3.73e-11	152	304	376	558	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	3.74e-11	152	304	380	562	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	3.76e-11	152	304	386	568	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	3.50e-35	187	310	57	181	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O31976	6.52e-32	198	308	1430	1541	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	6.52e-32	198	308	1430	1541	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
P27380	3.64e-15	201	281	18	98	Transglycosylase OS=Enterobacteria phage PRD1 OX=10658 GN=VII PE=1 SV=3
A8ZWR8	8.36e-14	191	314	287	434	Membrane-bound lytic murein transglycosylase F OS=Desulfococcus oleovorans (strain DSM 6200 / JCM 39069 / Hxd3) OX=96561 GN=mltF PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.297637	0.596407	0.103295	0.001237	0.000664	0.000744

TMHMM  Annotations     

start	end
30	49