CAZyme Information: MGYG000002671_00133

Basic Information

• Species: Treponema_D sp002478955
• Lineage: Bacteria; Spirochaetota; Spirochaetia; Treponematales; Treponemataceae; Treponema_D; Treponema_D sp002478955
• CAZyme ID: MGYG000002671_00133
• CAZy Family: GH13
• CAZyme Description: Pullulanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
982		108066.58	4.6339

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002671	2505445	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 168503; End: 171451 Strand: +

Full Sequence      

MKKLKVLTALLAGAAIFLASCASDSGSDDSVKPEVAPGTVGEAADELLAAADLLKEVDQN
NEKTILFYYREDGKYADWALWLWENGGNGELAYSSTIGKFKSKNITYNEIPYNIGYMELD
SEMFADSAPLVKKAIEEKATLNFIIRDAKWNKDPGTDQAYDLAGGSHFMVISGDKDVYPV
STVMTPFISSASMETLTTMKVTLSVKYALESIPSANGFKVVATDGTIANIADVLNYNSQD
NRSNNFTNTILVKFESAPDFTKNWKLYNEKFEPVDGREISTQNAVKISLNDYKYEGDDLG
LTISGEKATFKVWAPIASDVKILFYDDVSKVGNFKAETVALNVSGSTTEESLKGEPSGSE
QMILDKDSGIWSYTLDSIRNKKYYKYQITNNGTVYYVADIYAKSCSPDSIASQIVDINAD
SNYGTKSNYVNPFGTNGATEKDYTDAVIYEMHIRDWSRAVNPTSTGKFNDMCSDEIIAHL
KDLGITHVQILPMFDYAQVNADSGYNWGYNPYHYNVPEGRYTDYSANPDGTAAVEQMRAM
IKKFHDAKIAVIMDVVYNHTSGTAGGSLYDSTVPYYYYRLNSDGTYSNGSGCGNETDSEA
PMFRKYMIDTLKHWMLDYHINGFRFDLMELHSKEAMAEIYRELSSIDKNVMVYGEPWTGG
DAAVKDGAKTAIETGSYGVGAFDDDFRDAIKGAEYGGLNLGQIQGIKSIGDDGNFVVDSN
NKVVVTYNDDGIIAGLRGKSGKNNRNTTDKLGLALHYAECHDNYTLFDKLVYTLDENFPT
SKKADSDKDGSKIATTWPAAITEEQLELIKKEDKLAAAYVLLSQGTPFINGGQEFLRTKK
GNPDSYSADTKGGVAWTNTPGEHNIDDVNTIDLSMKSNNKDVYDTYKGLIALRKDNPSVF
GKSTDALATKAKVMNSDEKEVRVAGVTKYTTGDFLVYFNATDSDVKITTTGYTKSVDVSS
GVPKDVEIVSTVPAKSFVILKK

Enzyme Prediction     

No EC number prediction in MGYG000002671_00133.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	478	834	2.7e-89	0.9930795847750865

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11341	AmyAc_Pullulanase_LD-like	3.74e-159	444	893	1	406	Alpha amylase catalytic domain found in Pullulanase (also called dextrinase; alpha-dextrin endo-1,6-alpha glucosidase), limit dextrinase, and related proteins. Pullulanase is an enzyme with action similar to that of isoamylase; it cleaves 1,6-alpha-glucosidic linkages in pullulan, amylopectin, and glycogen, and in alpha-and beta-amylase limit-dextrins of amylopectin and glycogen. Pullulanases are very similar to limit dextrinases, although they differ in their action on glycogen and the rate of hydrolysis of limit dextrins. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase.
TIGR02104	pulA_typeI	7.27e-152	289	948	3	585	pullulanase, type I. Pullulan is an unusual, industrially important polysaccharide in which short alpha-1,4 chains (maltotriose) are connected in alpha-1,6 linkages. Enzymes that cleave alpha-1,6 linkages in pullulan and release maltotriose are called pullulanases although pullulan itself may not be the natural substrate. This family consists of pullulanases related to the subfamilies described in TIGR02102 and TIGR02103 but having a different domain architecture with shorter sequences. Members are called type I pullulanases.
COG1523	PulA	6.97e-101	308	904	69	595	Pullulanase/glycogen debranching enzyme [Carbohydrate transport and metabolism].
PLN02877	PLN02877	6.64e-75	292	879	209	803	alpha-amylase/limit dextrinase
TIGR02102	pullulan_Gpos	3.01e-67	68	948	118	954	pullulanase, extracellular, Gram-positive. Pullulan is an unusual, industrially important polysaccharide in which short alpha-1,4 chains (maltotriose) are connected in alpha-1,6 linkages. Enzymes that cleave alpha-1,6 linkages in pullulan and release maltotriose are called pullulanases although pullulan itself may not be the natural substrate. In contrast, a glycogen debranching enzyme such GlgX, homologous to this family, can release glucose at alpha,1-6 linkages from glycogen first subjected to limit degradation by phosphorylase. Characterized members of this family include a surface-located pullulanase from Streptococcus pneumoniae () and an extracellular bifunctional amylase/pullulanase with C-terminal pullulanase activity (.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQA01551.1	3.12e-313	5	982	8	897
QSI02745.1	7.94e-217	299	982	265	878
AEB13374.1	2.50e-200	274	982	1	613
QJS18678.1	1.38e-110	34	979	123	970
CEP78254.1	1.37e-104	65	910	59	807

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WAN_A	2.42e-93	247	921	271	852	Pullulanasefrom Bacillus acidopullulyticus [Bacillus acidopullulyticus]
7LSA_A	7.02e-79	277	979	42	703	ChainA, Pullulanase [Ruminococcus bromii]
7LSR_A	8.91e-78	277	979	42	703	ChainA, Pullulanase [Ruminococcus bromii]
7LSU_A	9.23e-78	277	979	42	703	ChainA, Pullulanase [Ruminococcus bromii]
7LST_A	9.40e-78	277	979	42	703	ChainA, Pullulanase [Ruminococcus bromii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O33840	4.21e-94	65	907	24	759	Pullulanase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=pulA PE=1 SV=2
C0SPA0	1.23e-55	290	898	98	618	Pullulanase OS=Bacillus subtilis (strain 168) OX=224308 GN=amyX PE=1 SV=1
P07811	1.26e-49	300	909	315	953	Pullulanase OS=Klebsiella aerogenes OX=548 GN=pulA PE=1 SV=1
A0A0H2UNG0	1.17e-47	68	940	250	1082	Pullulanase A OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=spuA PE=1 SV=1
P07206	3.53e-47	275	882	276	919	Pullulanase OS=Klebsiella pneumoniae OX=573 GN=pulA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000088	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002671_00133.