CAZyme Information: MGYG000002671_01356

Basic Information

• Species: Treponema_D sp002478955
• Lineage: Bacteria; Spirochaetota; Spirochaetia; Treponematales; Treponemataceae; Treponema_D; Treponema_D sp002478955
• CAZyme ID: MGYG000002671_01356
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
479		54251.37	6.8391

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002671	2505445	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 14941; End: 16380 Strand: +

Full Sequence      

MKILMVSAEAIPFAKTGGLADAVTALAKALVEAGQEVKILIPRYYFIDRKNLILEKKSVL
LNIGFSDIVVNFYSTTYENVQIYFVDYEKLFGRSGIYGENAQSAYADNPLRFSVLARAAF
ALCRELAWIPDIMHANDWSSGMVPVILKYFEKENFRNTKSVLTIHNLAYQGTFSDRAFPL
LGLPPEFKTKAWFDQYGSINFLKAAIFCADKITTVSPSYAKEISGLEFGCGLDGLIRLRS
KDFEGIINGADLSEWNPEKDKYIPFQYSKENLENKAKNKAELQKRFGLKVDPEIPVVGIV
CRLVEQKGIKELFAPNYGSMYRMCKDFNVQFVIAGTGESWCEDEIRNLSKVLPNLARFEG
YSEEISHLIEAGSDYFLMPSKYEPCGLNQIYSMIYGTLPIVHDTGGLSDTVTQFDESTES
GTGFKFTDLTPDAIYGTVKWALSFFTNKKLMKKLRLKAMNQDFSWKKSAEEYITKIYRN

Enzyme Prediction     

No EC number prediction in MGYG000002671_01356.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	2	475	1.2e-167	0.9915254237288136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02095	glgA	0.0	1	479	1	472	glycogen/starch synthase, ADP-glucose type. This family consists of glycogen (or starch) synthases that use ADP-glucose (EC 2.4.1.21), rather than UDP-glucose (EC 2.4.1.11) as in animals, as the glucose donor. This enzyme is found in bacteria and plants. Whether the name given is glycogen synthase or starch synthase depends on context, and therefore on substrate. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
PRK00654	glgA	0.0	1	479	1	462	glycogen synthase GlgA.
cd03791	GT5_Glycogen_synthase_DULL1-like	0.0	2	479	1	474	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
COG0297	GlgA	2.22e-156	1	478	1	476	Glycogen synthase [Carbohydrate transport and metabolism].
PRK14099	PRK14099	1.19e-118	1	479	4	478	glycogen synthase GlgA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIN94601.1	2.21e-181	1	477	1	480
AAS12099.1	2.92e-179	1	477	1	480
CAV22808.1	2.92e-179	1	477	1	480
QOS39953.1	1.22e-178	1	473	1	478
QPZ99906.1	9.58e-178	1	473	1	478

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4HLN_A	2.04e-87	3	472	127	618	Structureof barley starch synthase I in complex with maltooligosaccharide [Hordeum vulgare]
3D1J_A	6.23e-87	1	478	1	475	ChainA, Glycogen synthase [Escherichia coli]
2QZS_A	1.20e-85	1	478	1	475	CrystalStructure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSb) [Escherichia coli],2R4T_A Crystal Structure of Wild-type E.coli GS in Complex with ADP and Glucose(wtGSc) [Escherichia coli],2R4U_A Crystal Structure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSd) [Escherichia coli],3GUH_A Crystal Structure of Wild-type E.coli GS in complex with ADP and DGM [Escherichia coli K-12]
3COP_A	9.34e-85	1	478	1	475	ChainA, Glycogen synthase [Escherichia coli],3CX4_A Chain A, Glycogen synthase [Escherichia coli]
1RZU_A	4.34e-78	1	472	1	468	ChainA, Glycogen synthase 1 [Agrobacterium tumefaciens],1RZU_B Chain B, Glycogen synthase 1 [Agrobacterium tumefaciens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q73MC7	5.85e-180	1	477	1	480	Glycogen synthase OS=Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104) OX=243275 GN=glgA PE=3 SV=1
Q1ILA0	9.15e-114	1	473	1	469	Glycogen synthase OS=Koribacter versatilis (strain Ellin345) OX=204669 GN=glgA PE=3 SV=1
A7H6L1	1.75e-111	1	472	1	465	Glycogen synthase OS=Anaeromyxobacter sp. (strain Fw109-5) OX=404589 GN=glgA PE=3 SV=1
Q39XS5	1.77e-109	1	472	4	478	Glycogen synthase 1 OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=glgA1 PE=3 SV=1
B8J8R4	4.18e-107	1	472	1	466	Glycogen synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) OX=455488 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000035	0.000005	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002671_01356.