CAZyme Information: MGYG000002672_01202

Basic Information

• Species: UMGS911 sp003343545
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; UMGS911; UMGS911 sp003343545
• CAZyme ID: MGYG000002672_01202
• CAZy Family: CE4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
332		37234.5	4.4811

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002672	2438668	MAG	Canada	North America

• Gene Location: Start: 52680; End: 53678 Strand: +

Full Sequence      

MYIRSVLDKSRNSIKSKKFCRKTAILILGILFIDAVLTLCGCSQKTGGVGQNDTLPFTEE
RDITALLDTDTEYNNTSETDTSPESSEADTGGLLTLPETVSEPEPRPAHKSWHKYAEDGG
YPAAIMYHLILDEPYSSETDLFVKPESFAKTLDVLDAHDYIYLFADEYAKNDKKSVALTF
DDGYEDNYTNMFPILKEHGAKATIFLIADNIGTEGYLSEAQIREMADSGLVKFGSHTKTH
RNLTELNEQELRYEFSESQKTIEKISGQLCDSVAYPGGQHNSEVMKIAAEYYNFAYTTKS
PNSVFEYSEMNIPRHYGARSLGAEGLLEIIEY

Enzyme Prediction     

No EC number prediction in MGYG000002672_01202.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE4	169	291	3.4e-34	0.8923076923076924

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10918	CE4_NodB_like_5s_6s	4.14e-54	175	316	1	153	Putative catalytic NodB homology domain of PgaB, IcaB, and similar proteins which consist of a deformed (beta/alpha)8 barrel fold with 5- or 6-strands. This family belongs to the large and functionally diverse carbohydrate esterase 4 (CE4) superfamily, whose members show strong sequence similarity with some variability due to their distinct carbohydrate substrates. It includes bacterial poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB, hemin storage system HmsF protein in gram-negative species, intercellular adhesion proteins IcaB, and many uncharacterized prokaryotic polysaccharide deacetylases. It also includes a putative polysaccharide deacetylase YxkH encoded by the Bacillus subtilis yxkH gene, which is one of six polysaccharide deacetylase gene homologs present in the Bacillus subtilis genome. Sequence comparison shows all family members contain a conserved domain similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, which consists of a deformed (beta/alpha)8 barrel fold with 6 or 7 strands. However, in this family, most proteins have 5 strands and some have 6 strands. Moreover, long insertions are found in many family members, whose function remains unknown.
cd10969	CE4_Ecf1_like_5s	2.63e-38	145	314	1	199	Putative catalytic NodB homology domain of a hypothetical protein Ecf1 from Escherichia coli and similar proteins. This family contains a hypothetical protein Ecf1 from Escherichia coli and its prokaryotic homologs. Although their biochemical properties remain to be determined, members in this family contain a conserved domain with a 5-stranded beta/alpha barrel, which is similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, belonging to the larger carbohydrate esterase 4 (CE4) superfamily.
cd10970	CE4_DAC_u1_6s	2.15e-36	176	302	3	129	Putative catalytic NodB homology domain of uncharacterized prokaryotic polysaccharide deacetylases which consist of a 6-stranded beta/alpha barrel. This family contains uncharacterized prokaryotic polysaccharide deacetylases. Although their biological functions remain unknown, all members of the family contain a conserved domain with a 6-stranded beta/alpha barrel, which is similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, belonging to the larger carbohydrate esterase 4 (CE4) superfamily.
pfam01522	Polysacc_deac_1	3.87e-34	172	291	5	119	Polysaccharide deacetylase. This domain is found in polysaccharide deacetylase. This family of polysaccharide deacetylases includes NodB (nodulation protein B from Rhizobium) which is a chitooligosaccharide deacetylase. It also includes chitin deacetylase from yeast, and endoxylanases which hydrolyzes glucosidic bonds in xylan.
cd10973	CE4_DAC_u4_5s	3.11e-31	174	314	1	150	Putative catalytic NodB homology domain of uncharacterized bacterial polysaccharide deacetylases which consist of a 5-stranded beta/alpha barrel. This family contains many uncharacterized bacterial polysaccharide deacetylases. Although their biological functions remain unknown, all members of the family are predicted to contain a conserved domain with a 5-stranded beta/alpha barrel, which is similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, belonging to the larger carbohydrate esterase 4 (CE4) superfamily.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOR62958.1	1.56e-29	111	300	20	232
QKF67963.1	6.67e-29	141	298	14	192
QQN38882.1	1.46e-28	111	299	20	231
QMU04360.1	2.91e-28	111	298	20	230
QQT65603.1	7.86e-28	111	290	20	221

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4V33_A	8.17e-23	125	299	147	325	Crystalstructure of the putative polysaccharide deacetylase BA0330 from bacillus anthracis [Bacillus anthracis],4V33_B Crystal structure of the putative polysaccharide deacetylase BA0330 from bacillus anthracis [Bacillus anthracis]
4HD5_A	2.11e-22	125	299	147	325	CrystalStructure of BC0361, a polysaccharide deacetylase from Bacillus cereus [Bacillus cereus ATCC 14579]
6GO1_A	1.42e-17	125	331	103	318	CrystalStructure of a Bacillus anthracis peptidoglycan deacetylase [Bacillus anthracis],6GO1_B Crystal Structure of a Bacillus anthracis peptidoglycan deacetylase [Bacillus anthracis]
6DQ3_A	4.58e-16	125	331	12	229	ChainA, Polysaccharide deacetylase [Streptococcus pyogenes],6DQ3_B Chain B, Polysaccharide deacetylase [Streptococcus pyogenes]
5O6Y_A	1.95e-11	160	290	10	133	Crystalstructure of the Bc1960 peptidoglycan N-acetylglucosamine deacetylase in complex with 4-naphthalen-1-yl-~{N}-oxidanyl-benzamide [Bacillus cereus ATCC 14579]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P94361	1.37e-23	111	288	55	232	Putative polysaccharide deacetylase YxkH OS=Bacillus subtilis (strain 168) OX=224308 GN=yxkH PE=3 SV=1
Q6GDD6	1.09e-12	143	314	77	268	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=icaB PE=3 SV=1
Q8NUI6	1.47e-12	143	314	77	268	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus aureus (strain MW2) OX=196620 GN=icaB PE=3 SV=1
Q7A349	1.47e-12	143	314	77	268	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus aureus (strain N315) OX=158879 GN=icaB PE=3 SV=1
Q9RQP7	1.47e-12	143	314	77	268	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=icaB PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001729	0.224774	0.773282	0.000133	0.000058	0.000027

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002672_01202.