CAZyme Information: MGYG000002674_00355

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes
• CAZyme ID: MGYG000002674_00355
• CAZy Family: PL35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
646		71198.71	4.7322

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002674	2150198	MAG	Canada	North America

• Gene Location: Start: 10650; End: 12590 Strand: -

Full Sequence      

MKLLTRAIWIVALFCTLSACSDDDKATFTPGSGGTTQGGGNGGNTPSGGGDYSQLTAANH
PRIIMTEEDVTAIRTKLDAGTDANLKALHDCIINYADKTLTAKDLVYEVKGKRLLDVSTE
AANRIISCSYAYRLTGETKYLDKAKKDLQTVCAFKDWNSATHFLDGAEMAHGVGIGYDWL
YNELDDATRQSAEKAIQDYAFYCALNGKWNLNFYESATNWNQVCNGGLVVAALAIYETCP
DQAQQIIDKAIESNASAMDEMYNPDGNYPEGYGYWGYGTAFECIMLAAMESCTGTDNGLA
NIEGFKKTGKWILFMEGMNKEAFNYCDCAPSSVAFPPLWYLAYKFNDQSLLYGELIKLKD
GRYTSYDGQKYFPMAIVYASKFDLNAVTPPTDKIWSGKGINPVVLVHSDWSFSDTDKFLG
MKAGRANYSHGHMDVGSFVYDAYGTRWSADLGLQSYGTIENVTLPGYTGNFGSYDQGAFR
WAVFRYNNYNHSTITINDALHKASGRAEIISVIDSETSKGGVIDMTDILDDECEKATRTI
TLDNDTDLIVKDQIKAYYNKAADVRWTMVTKAMPVVEANRIVLQGKNKNLYLTVSSEKGA
KITLKTWSTVGESYDASNAGYYEAGFEARVTSGQTDTFTVKLSPNE

Enzyme Prediction     

No EC number prediction in MGYG000002674_00355.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL35	415	598	1.9e-57	0.9832402234636871

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04792	LanM-like	5.56e-05	85	253	555	741	Cyclases involved in the biosynthesis of class II lantibiotics, and similar proteins. LanM-like proteins. LanM is a bifunctional enzyme, involved in the synthesis of class II lantibiotics. It is responsible for both the dehydration and the cyclization of the precursor-peptide during lantibiotic synthesis. The C-terminal domain shows similarity to LanC, the cyclase component of the lan operon, but the N terminus seems to be unrelated to the dehydratase, LanB.
pfam16332	DUF4962	8.51e-04	58	244	135	334	Domain of unknown function (DUF4962). This family consists of uncharacterized proteins around 870 residues in length and is mainly found in various Bacteroides species. The function of this protein is unknown.
pfam05147	LANC_like	0.003	125	360	15	253	Lanthionine synthetase C-like protein. Lanthionines are thioether bridges that are putatively generated by dehydration of Ser and Thr residues followed by addition of cysteine residues within the peptide. This family contains the lanthionine synthetase C-like proteins 1 and 2 which are related to the bacterial lanthionine synthetase components C (LanC). LANCL1 (P40 seven-transmembrane-domain protein) and LANCL2 (testes-specific adriamycin sensitivity protein) are thought to be peptide-modifying enzyme components in eukaryotic cells. Both proteins are produced in large quantities in the brain and testes and may have role in the immune surveillance of these organs. Lanthionines are found in lantibiotics, which are peptide-derived, post-translationally modified antimicrobials produced by several bacterial strains. This region contains seven internal repeats.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK62761.1	0.0	1	646	1	645
SCV07259.1	4.63e-232	1	644	1	642
QRQ54740.1	4.63e-232	1	644	1	642
ALJ47854.1	4.63e-232	1	644	1	642
QNL40060.1	9.29e-232	1	644	1	642

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000002	0.000602	0.999437	0.000000	0.000001	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002674_00355.