CAZyme Information: MGYG000002674_00879

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes
• CAZyme ID: MGYG000002674_00879
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
334	MGYG000002674_57|CGC1	37723.43	6.4835

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002674	2150198	MAG	Canada	North America

• Gene Location: Start: 6864; End: 7868 Strand: +

Full Sequence      

MKYLLAILAWVAGLGTAAAREAVYTVDCNGSGDFLTVQACFDALPSKPTEWRTVRILPGT
YREKVTLDVYKDRVRIVGVGGASAVRIVWNDYSGKVVDGYEMSTYDTWTLSLQADDVLLE
GVTVENDAGRVGQAVALETRGDRIRIDRCRLVGDQDTFFTKGYVSRVWVTDTWIEGTTDF
IFGPSIVLFDRCRIHGKADSFLTAASTTERNLYGYVFRDCRVTTDPAVKRLYLGRPWKST
ARTVWIRCELPAAIRPEGWRDWHDSARKGDVYYAEYRCTGPGADRSARVDWSRELSDEEA
ACYTPERIFAKKTGSEQFRSDWNPQRDVTRFGGD

Enzyme Prediction     

No EC number prediction in MGYG000002674_00879.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	25	309	4.7e-84	0.9826388888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PLN02432	PLN02432	1.65e-61	18	301	7	278	putative pectinesterase
PLN02773	PLN02773	2.39e-60	23	301	6	288	pectinesterase
PLN02682	PLN02682	1.45e-58	25	300	72	352	pectinesterase family protein
COG4677	PemB	2.02e-49	13	311	74	404	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02708	PLN02708	3.18e-49	25	304	244	538	Probable pectinesterase/pectinesterase inhibitor

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK62969.1	8.36e-164	18	323	18	322
AMR29655.1	9.39e-82	20	314	11	301
QKG53054.1	1.24e-77	17	304	21	307
QKG58922.1	2.20e-77	29	325	20	305
ALJ00091.1	5.81e-77	17	326	17	315

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	1.06e-32	29	291	10	277	ChainA, Pectinesterase 1 [Solanum lycopersicum]
5C1E_A	2.44e-22	29	288	14	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	3.36e-22	29	288	14	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
4PMH_A	1.19e-15	21	239	39	294	Thestructure of rice weevil pectin methyl esterase [Sitophilus oryzae]
3GRH_A	8.23e-06	113	190	199	291	Crystalstructure of escherichia coli ybhc [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	2.18e-45	19	300	2	287	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q9FM79	5.68e-42	23	299	81	362	Pectinesterase QRT1 OS=Arabidopsis thaliana OX=3702 GN=QRT1 PE=1 SV=1
Q9SIJ9	6.06e-42	26	303	53	320	Putative pectinesterase 11 OS=Arabidopsis thaliana OX=3702 GN=PME11 PE=3 SV=1
Q8VYZ3	6.95e-38	29	300	91	366	Probable pectinesterase 53 OS=Arabidopsis thaliana OX=3702 GN=PME53 PE=2 SV=1
Q9FJ21	1.01e-36	14	308	250	552	Probable pectinesterase/pectinesterase inhibitor 58 OS=Arabidopsis thaliana OX=3702 GN=PME58 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000404	0.998879	0.000214	0.000176	0.000163	0.000159

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002674_00879.