CAZyme Information: MGYG000002674_01240

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes
• CAZyme ID: MGYG000002674_01240
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
536	MGYG000002674_103|CGC1	60233.58	9.3538

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002674	2150198	MAG	Canada	North America

• Gene Location: Start: 1833; End: 3443 Strand: -

Full Sequence      

MKQNRLYALSAAFLLALLPVLILRDFTPSNELRYLSIADEALRDGHLFAFTCQGEPYADK
PPLYLWIIMLGKILFGQHRMWFLALFSFLPALGILFTMDRWTRSLLDERRRTTAAMMLMT
CGLFLGLAVFLRMDMLMCLFITLALYCFWKIYSGEGDTSSNRILLPVWTLLALFTKGPVG
LLVPLVSTVVFLIAKRRSKEIGHYWGWISWTIIGGGCALWFAEVWLEGGPDYFNNLLFHQ
TIDRAVDAFHHKEPVWYYLGSIWYSLAPWSLFILGVIAAALFRREKRSDLELFFLTVILT
TLVMLSVFSSKIAVYLAPTFPFFVYLSLLLVRHLRPSRWLKATVALPALIWVAVPFATIM
LARSEAFAVLRNGWILAAAVILGATGLMTLLRLLRTSAPIDTPICLLAAGTILASCAGGI
ALPKLNAQLGYGTLCREVIRLSSPEKVPTVYTWGIRRSESMDVYLGEDVVPLTTEQILAG
ECSDGVLLLPTRKLDDDPAMRRFVANRPRHAVGQYLIVEIKPPVTDGLPRTNRAGV

Enzyme Prediction     

No EC number prediction in MGYG000002674_01240.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	3	475	9.9e-72	0.8814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	1.88e-30	24	386	28	394	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	1.33e-18	31	383	33	394	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	2.69e-06	59	213	1	150	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	0.002	54	206	56	219	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
pfam06638	Strabismus	0.005	265	341	133	231	Strabismus protein. This family consists of several strabismus (STB) or Van Gogh-like (VANGL) proteins 1 and 2. The exact function of this family is unknown. It is thought, however that STB1 gene and STB2 may be potent tumor suppressor gene candidates.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTO25703.1	4.26e-162	14	518	11	515
QUU03965.1	6.03e-162	14	518	11	515
QKH86812.1	2.42e-161	14	518	11	515
QRP88934.1	6.88e-161	14	518	11	515
QLK84536.1	1.95e-160	14	518	11	515

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	1.39e-06	23	373	51	434	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q3KCC9	8.83e-18	30	377	49	411	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 1 OS=Pseudomonas fluorescens (strain Pf0-1) OX=205922 GN=arnT1 PE=3 SV=1
A1JPM4	4.51e-16	30	318	33	321	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) OX=393305 GN=arnT PE=3 SV=1
B7UFR9	7.86e-16	30	404	31	373	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) OX=574521 GN=arnT PE=3 SV=1
B7N5M2	1.33e-14	30	404	31	373	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) OX=585056 GN=arnT PE=3 SV=1
Q32DT1	1.33e-14	30	404	31	373	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Shigella dysenteriae serotype 1 (strain Sd197) OX=300267 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.988273	0.011572	0.000081	0.000025	0.000021	0.000064

TMHMM  Annotations     

start	end
7	24
80	102
123	145
170	192
204	226
255	277
290	308
312	331
343	362
372	394
403	422