CAZyme Information: MGYG000002676_01865

Basic Information

• Species: QALR01 sp900552255
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; QALR01; QALR01 sp900552255
• CAZyme ID: MGYG000002676_01865
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
364		41764.52	4.6707

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002676	2126520	MAG	Canada	North America

• Gene Location: Start: 14987; End: 16081 Strand: +

Full Sequence      

MNETKKRCSFARICEALLLLFCTIALIFSTGSGYVKRLLESYRYPREFREYVEEYAALYG
VEANIVYAIIKAESGFCRTAVSRSGAIGLMQVIPDTYLLDIRDNIGLDEPSSILFQAKEN
IQSGTYYFAKWYGHFGSYVEALAAYNAGVGNVQRWLADETISTTSGLIIEKIPFEETKNY
INRVLFYKEKYDELYGKEELPQEDTINERLCYEWAVKYGEQYKIDPRFVMAVVKAESSFR
PDCVSVSGAVGMMQIMKPTYEGDIKANLKLEEEFDALFDAEFNVKCGTYYLHWLDERLDG
YEQLAAAYNGGIGNVRKWLADPTYSSDGKTLIVDNIPLDQTKRYVRKVMAFYEEYCLRYP
DVTG

Enzyme Prediction     

No EC number prediction in MGYG000002676_01865.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	223	355	2.7e-25	0.8222222222222222
GH23	64	190	5.3e-25	0.7851851851851852

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	1.72e-48	217	353	10	145	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd16896	LT_Slt70-like	1.26e-46	45	190	1	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.77e-41	43	194	1	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd13401	Slt70-like	7.32e-38	210	355	4	149	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	2.24e-30	226	353	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIS52076.1	6.30e-32	213	359	37	182
QUH21145.1	2.66e-30	217	355	46	183
CEI72025.1	4.92e-30	18	198	6	183
QNU68364.1	5.79e-30	24	199	20	192
CBH21525.1	2.94e-29	24	195	10	177

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	3.76e-18	36	201	404	565	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	3.78e-18	36	201	408	569	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	3.81e-18	36	201	414	575	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	3.83e-18	36	201	418	579	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	3.86e-18	36	201	424	585	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	3.44e-15	52	184	64	175	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
P39434	4.42e-14	43	218	475	645	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
P0AGC4	8.00e-13	43	218	475	645	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P0AGC3	8.00e-13	43	218	475	645	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
O64046	1.13e-12	44	185	1418	1538	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.971076	0.026149	0.000336	0.000091	0.000047	0.002316

TMHMM  Annotations     

start	end
13	35