CAZyme Information: MGYG000002681_01460

Basic Information

• Species: UMGS1975 sp900546685
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; QAND01; UMGS1975; UMGS1975 sp900546685
• CAZyme ID: MGYG000002681_01460
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
344		37598.46	8.0043

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002681	1889419	MAG	Canada	North America

• Gene Location: Start: 42; End: 1076 Strand: +

Full Sequence      

MTPNIALLPALCKMGCEIHYIGDVNGMEKRLMAPFDFVTYHGISTGKLRRYLSVQNLKDP
FKVLKGISQSKKLLGEIRPDVIFAKGGFVSVPVVMAAKKHKIPVVLHESDFTIGLANRIS
APRASIVCTSFAPTVNEVKGGHGVWTGSPVREELLHATRTQAQDFFKFPVPEQPTLVFMG
GSLGAQALNRALSDCFEALVCRYNIIHIAGRGNLDPGLAHPNYRAYEYLTEEMPLVFAAA
DLFVCRSGANTLFELLATKRPGVLVPLPSKSSRGDQLLNAEFFAEQGYADVLPQETITPE
SLQAAIHHGLETAQAKQQAMAQSPMQNGTENVLRQIKVAAGWEE

Enzyme Prediction     

No EC number prediction in MGYG000002681_01460.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	175	323	2.2e-38	0.9363057324840764

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00726	murG	1.48e-121	1	308	15	320	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
PRK12446	PRK12446	2.63e-105	1	308	15	318	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed
cd03785	GT28_MurG	3.02e-104	3	306	15	318	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0707	MurG	3.20e-94	1	306	14	318	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
pfam04101	Glyco_tran_28_C	1.85e-32	175	306	1	137	Glycosyltransferase family 28 C-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). Structural analysis suggests the C-terminal domain contains the UDP-GlcNAc binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWT56147.1	3.64e-118	1	340	16	353
QDW72608.1	1.31e-106	1	340	15	353
BBF44674.1	1.21e-104	1	337	15	350
QUO31473.1	7.88e-103	1	340	15	353
AYH40137.1	2.17e-102	1	341	16	351

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7D1I_A	2.31e-36	3	302	25	326	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]
3S2U_A	4.55e-35	3	306	18	318	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
1F0K_A	9.65e-26	3	302	22	315	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0Q182	2.81e-102	1	337	17	353	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Clostridium novyi (strain NT) OX=386415 GN=murG PE=3 SV=1
A9KK83	7.48e-102	1	337	15	350	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) OX=357809 GN=murG PE=3 SV=1
Q97GY4	5.53e-100	1	336	17	351	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=murG PE=3 SV=1
C3L230	1.34e-99	1	337	15	350	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Clostridium botulinum (strain 657 / Type Ba4) OX=515621 GN=murG PE=3 SV=1
C1FUF9	7.61e-99	1	337	15	350	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Clostridium botulinum (strain Kyoto / Type A2) OX=536232 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000086	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002681_01460.