CAZyme Information: MGYG000002683_00425

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; RUG12999; RUG12999
• CAZyme ID: MGYG000002683_00425
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
419	MGYG000002683_16|CGC1	48939.85	8.9387

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002683	3225682	MAG	Canada	North America

• Gene Location: Start: 21388; End: 22647 Strand: -

Full Sequence      

MLYYLFAVENYLWRILSACFLYQVFYTIFMLLRNRKKDEHKEASKNYKYGIIVSARNESR
VIGYLLDSINAQNYDKDKIKIYVVADNCTDDTAQVARDRGAIVYERFNTQLVGKGYALDY
LFKKIMHTDDSDAYIVFDADNIVDRNFIYEMNKVYDEGYKVITSYRNSKNYDSTWISAGY
SLWFIRESRYLNHARCKLHTSCAISGTGFLIDKSLILENNGWKYHLLTEDIELTVDYVCN
GNKVGFSNKSVLYDEQPLKFSQSWTQRMRWSKGFYQIIPRYWKRLFKGILKGNFACFDMF
MTVCPTIFATLYSLFCLAIKIVNVAVLGDVEILLSAGKMLVPMIFGSYFLLYAMGIITII
TEWKNIKCNHKNVIKYSFTFPVFMLSYIPISVVALFKKVHWAPIEHSVVKKSVSEITEE

Enzyme Prediction     

No EC number prediction in MGYG000002683_00425.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	50	271	6.3e-22	0.9695652173913043

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06438	EpsO_like	1.82e-84	51	233	1	183	EpsO protein participates in the methanolan synthesis. The Methylobacillus sp EpsO protein is predicted to participate in the methanolan synthesis. Methanolan is an exopolysaccharide (EPS), composed of glucose, mannose and galactose. A 21 genes cluster was predicted to participate in the methanolan synthesis. Gene disruption analysis revealed that EpsO is one of the glycosyltransferase enzymes involved in the synthesis of repeating sugar units onto the lipid carrier.
COG1215	BcsA	1.17e-32	2	396	1	406	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06423	CESA_like	4.15e-32	51	230	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
pfam13641	Glyco_tranf_2_3	9.79e-20	49	273	4	230	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
cd06439	CESA_like_1	1.34e-15	18	147	1	134	CESA_like_1 is a member of the cellulose synthase (CESA) superfamily. This is a subfamily of cellulose synthase (CESA) superfamily. CESA superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members of the superfamily include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUO18464.1	8.00e-151	17	410	16	408
QNM06492.1	2.53e-144	17	416	17	416
BCI61275.1	1.72e-143	17	416	17	422
AYH41686.1	7.64e-135	17	410	6	406
QJS20330.1	1.48e-134	15	418	14	412

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96587	7.65e-16	48	413	50	406	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1
P74165	3.72e-08	51	283	112	345	Beta-monoglucosyldiacylglycerol synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=sll1377 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
10	32
307	329
339	361
374	396