CAZyme Information: MGYG000002683_00715

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; RUG12999; RUG12999
• CAZyme ID: MGYG000002683_00715
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
244	MGYG000002683_31|CGC1	28590.14	8.2571

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002683	3225682	MAG	Canada	North America

• Gene Location: Start: 15421; End: 16155 Strand: -

Full Sequence      

MSIPKKIHYCWFGRGKLPRLAEKCIKSWEKYCPDFEIICWNEDNFDLNQNRYIREAYEAG
KWAFVSDYVRLKVICEYGGIYLDTDVELIKSLEPLLGGKGYMGFDEKGIVATGLGFAAEP
GNEIIAEMLKEYDNIPFVLPDGTYDMTPCPDRNTDALKRLGMDIKNTNQTFMGMRFLPRE
YLCPMDYYTGKIEKTKNTYSIHHYCASWTSAVTKRTTRIKRIIGVKMYDKLYGKFLHKFK
WLEW

Enzyme Prediction     

No EC number prediction in MGYG000002683_00715.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	21	96	2.9e-24	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	8.82e-18	3	147	82	231	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	3.73e-17	18	97	1	88	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam05704	Caps_synth	1.31e-10	3	93	46	141	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
pfam12919	TcdA_TcdB	1.84e-05	42	85	140	193	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUO31225.1	5.59e-92	3	224	2	225
QCW96683.1	1.58e-79	3	237	2	238
AZQ18018.1	1.58e-79	3	237	2	238
QSP99106.1	1.58e-79	3	237	2	238
QQJ91624.1	1.58e-79	3	237	2	238

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q10323	9.97e-07	2	96	56	153	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000083	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002683_00715.