CAZyme Information: MGYG000002683_00803

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; RUG12999; RUG12999
• CAZyme ID: MGYG000002683_00803
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
694		80123.84	5.2295

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002683	3225682	MAG	Canada	North America

• Gene Location: Start: 7442; End: 9526 Strand: +

Full Sequence      

MERNHLITCKSAGFSKNGVIYFRKKFESEKGGRLRLNVFADARYKLYINGVFADAGPAKG
NDKELYFNEVDLSGFLKDGENEIEVRVLNLRSCGEMPQYLFLTSVRRSGSGVLEICGEAD
GKPFVTDGTWDCAADEGIEFRIPKYANYTGTPEYIDSDKYKKLNWEKAVVITDSPKLDWG
ETTPWHNKKSPVPNMKLEERKIELSPNGIFDFGYITTSYLKIVCAGKGKLRLTYAEKYKN
KNEVRTDKTGILEGDCDTLDLKGEEVVFEPYWFRCFRYIKTESEREIEISAAYAYETGYP
LDIKDDYDFGSEEDNKLWEISVRTLERCMQDTFTDCPYYEQLQYAMDTYLQSIYAYRISA
DDRLQRRAIRDFAMSVNSEGLVQSRTPSVRNQFIPCFSLYYIMMVLEHFERFGDEDLLYE
NIPQILQVLNWYEKHSNADGLVVRSPYWHFIDWAEEYMPLRGVPPYEDGATLGIESLMLS
YVLNRLGNDLKDTKYSGIAEMFTEKAERINRSAEEKYFSEETCAYSNTENKKTFSQHMQI
WAVLSGCAGDERAERIMKKSFEFKSAQATFAYAYFLFRALEKANLYYMREDMLNRLRRLT
KLGCTTLPETPVNSRSECHAWSAAAIYEFTVMDLGVKQCKNKILIKPYTDGRNSAKGTVM
TAFGEVYAEWKKVNGKVVLKYRAPEGAEVVTEGI

Enzyme Prediction     

No EC number prediction in MGYG000002683_00803.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	209	689	8.4e-79	0.9722222222222222
CBM67	7	174	2.3e-20	0.9488636363636364

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	5.95e-15	315	629	14	335	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	2.97e-05	642	690	11	62	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBI31976.1	8.31e-120	16	692	25	779
QNK59208.1	1.05e-117	38	690	40	751
QTH40607.1	2.24e-114	17	686	25	750
QTH43327.1	3.02e-114	19	692	28	779
ALS29952.1	2.01e-112	19	685	22	762

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OKX_A	2.28e-25	274	694	503	945	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000035	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002683_00803.