CAZyme Information: MGYG000002684_01916

Basic Information

• Species: UBA3818 sp900557155
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; UBA3818; UBA3818 sp900557155
• CAZyme ID: MGYG000002684_01916
• CAZy Family: GH77
• CAZyme Description: 4-alpha-glucanotransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
284		31673.01	5.14

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002684	2007927	MAG	Canada	North America

• Gene Location: Start: 2581; End: 3435 Strand: -

Full Sequence      

MIGDIPIYVAMDSADVWTGGSRFQLDENRQPTAVAGVPPDLFSATGQLWGNPLYDWQAME
QDGFSWWRARMASCAALYDLVRIDHFIGVVHYYAIPAGEDTAINGRWLTGPGEKLLEAIG
PTLAGKKIIAEDLGVVTPQVRRLLEKSGYPGMKLMEFAFDSDSTNENLPCHFEKNMVVYG
GTHDNETLAGFFGPGQSRRMLRFARRYLDVSQNVQIPWALIRAGYASCADTVVFQLQDFL
GLDNRARINTPSTLGGNWCWRLVKGQLSDDLAVKIRDLTELYGR

Enzyme Prediction     

No EC number prediction in MGYG000002684_01916.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH77	1	282	7.5e-97	0.5769230769230769

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK14508	PRK14508	2.28e-149	2	284	215	496	4-alpha-glucanotransferase; Provisional
pfam02446	Glyco_hydro_77	1.52e-129	2	262	201	457	4-alpha-glucanotransferase. These enzymes EC:2.4.1.25 transfer a segment of a (1,4)-alpha-D-glucan to a new 4-position in an acceptor, which may be glucose or (1,4)-alpha-D-glucan.
PLN02635	PLN02635	3.99e-111	1	284	240	525	disproportionating enzyme
COG1640	MalQ	2.24e-87	2	284	227	514	4-alpha-glucanotransferase [Carbohydrate transport and metabolism].
TIGR00217	malQ	5.31e-83	1	284	228	513	4-alpha-glucanotransferase. This enzyme is known as amylomaltase and disproportionating enzyme. [Energy metabolism, Biosynthesis and degradation of polysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYF39757.1	2.20e-135	1	284	217	499
ADU28083.1	2.20e-135	1	284	217	499
AYF42590.1	2.20e-135	1	284	217	499
QCN93338.1	2.20e-135	1	284	217	499
AVQ97095.1	2.20e-135	1	284	217	499

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2X1I_A	5.91e-88	2	284	211	499	glycosidehydrolase family 77 4-alpha-glucanotransferase from thermus brockianus [Thermus brockianus]
5CPQ_A	1.56e-87	1	284	278	563	Disproportionatingenzyme 1 from Arabidopsis - apo form [Arabidopsis thaliana],5CPQ_B Disproportionating enzyme 1 from Arabidopsis - apo form [Arabidopsis thaliana],5CPS_A Disproportionating enzyme 1 from Arabidopsis - maltotriose soak [Arabidopsis thaliana],5CPS_B Disproportionating enzyme 1 from Arabidopsis - maltotriose soak [Arabidopsis thaliana],5CPT_A Disproportionating enzyme 1 from Arabidopsis - beta cyclodextrin soak [Arabidopsis thaliana],5CPT_B Disproportionating enzyme 1 from Arabidopsis - beta cyclodextrin soak [Arabidopsis thaliana],5CQ1_A Disproportionating enzyme 1 from Arabidopsis - cycloamylose soak [Arabidopsis thaliana],5CQ1_B Disproportionating enzyme 1 from Arabidopsis - cycloamylose soak [Arabidopsis thaliana],5CSU_A Disproportionating enzyme 1 from Arabidopsis - acarviostatin soak [Arabidopsis thaliana],5CSU_B Disproportionating enzyme 1 from Arabidopsis - acarviostatin soak [Arabidopsis thaliana],5CSY_A Disproportionating enzyme 1 from Arabidopsis - acarbose soak [Arabidopsis thaliana],5CSY_B Disproportionating enzyme 1 from Arabidopsis - acarbose soak [Arabidopsis thaliana]
1FP8_A	5.23e-86	1	284	210	499	StructureOf The Amylomaltase From Thermus Thermophilus Hb8 In Space Group P21212 [Thermus thermophilus],1FP9_A Structure Of Amylomaltase From Thermus Thermophilus Hb8 In Space Group C2 [Thermus thermophilus]
1CWY_A	5.23e-86	1	284	210	499	CrystalStructure Of Amylomaltase From Thermus Aquaticus, A Glycosyltransferase Catalysing The Production Of Large Cyclic Glucans [Thermus aquaticus],1ESW_A X-Ray Structure Of Acarbose Bound To Amylomaltase From Thermus Aquaticus. Implications For The Synthesis Of Large Cyclic Glucans [Thermus aquaticus]
2OWC_A	2.44e-84	1	284	213	501	Structureof a covalent intermediate in Thermus thermophilus amylomaltase [Thermus thermophilus],2OWW_A Covalent intermediate in amylomaltase in complex with the acceptor analog 4-deoxyglucose [Thermus thermophilus],2OWX_A THERMUS THERMOPHILUS AMYLOMALTASE AT pH 5.6 [Thermus thermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q59266	1.61e-90	1	284	201	485	4-alpha-glucanotransferase OS=Clostridium butyricum OX=1492 GN=malQ PE=1 SV=1
P0A3Q0	1.32e-87	1	284	212	495	4-alpha-glucanotransferase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=malQ PE=3 SV=1
P0A3Q1	1.32e-87	1	284	212	495	4-alpha-glucanotransferase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=malQ PE=3 SV=1
P72785	5.23e-87	1	284	214	499	4-alpha-glucanotransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=malQ PE=3 SV=1
Q9LV91	1.15e-86	1	284	290	575	4-alpha-glucanotransferase DPE1, chloroplastic/amyloplastic OS=Arabidopsis thaliana OX=3702 GN=DPE1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000033	0.000002	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002684_01916.