CAZyme Information: MGYG000002685_00719

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales_A; UBA9506
• CAZyme ID: MGYG000002685_00719
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
473		53661.68	5.8288

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002685	3385444	MAG	Canada	North America

• Gene Location: Start: 4432; End: 5853 Strand: +

Full Sequence      

MKIWFAAAECAPFIKTGGLGDVAAAFPKALAQNGVEACVVLPLYKSIKQNFIEQFTFVTS
FTVPLSWRGVYCGVFRYEADGVRYYFLDNEYYFLRDSVYGDYDDGERYAFYCKAVLEMMQ
YLGDYPDVIHCNDWQAAMIPLFLKGFYQHLSGYGGIRTMFTIHNIEYQGKVSYSFLREVL
GMDEAYMQYLDYGGCVNLMFSAICLADKVTTVSPTYAEEVKTAFYGRGLQEVLSGVSYKF
CGILNGLDTVVCDPHTDPHLFHKYSTKAMAGKKIGKRRLQEMLGLHADTEIPIVAMITRL
VGHKGLDLVQYVLHEMMERRLQLVVLGTGDKAYEQMFWDAAGAYPGRVSANIRFDADLAS
KLYAGADMFLMPSLSEPCGLAQMIAMRYGTVPIVRETGGLKDTVWPINPETGEGRGFTFQ
SYNAHDMLGAVDRALSLYYDNRELWKKIVRSDMEQDFSWVRSAQQYIRIYESM

Enzyme Prediction     

No EC number prediction in MGYG000002685_00719.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	2	471	9.7e-176	0.9957627118644068

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00654	glgA	0.0	1	473	1	463	glycogen synthase GlgA.
TIGR02095	glgA	0.0	1	472	1	472	glycogen/starch synthase, ADP-glucose type. This family consists of glycogen (or starch) synthases that use ADP-glucose (EC 2.4.1.21), rather than UDP-glucose (EC 2.4.1.11) as in animals, as the glucose donor. This enzyme is found in bacteria and plants. Whether the name given is glycogen synthase or starch synthase depends on context, and therefore on substrate. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG0297	GlgA	0.0	1	473	1	478	Glycogen synthase [Carbohydrate transport and metabolism].
cd03791	GT5_Glycogen_synthase_DULL1-like	0.0	2	472	1	474	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
PLN02939	PLN02939	7.49e-111	7	472	488	966	transferase, transferring glycosyl groups

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOX62809.1	1.60e-180	1	473	1	472
QIA32150.1	9.25e-171	1	470	1	472
ANU40325.1	1.86e-170	1	470	1	472
QQR06905.1	1.86e-170	1	470	1	472
AEH53489.1	2.22e-168	1	473	1	473

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GNE_A	9.72e-93	7	470	16	494	Catalyticdomain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana],6GNE_B Catalytic domain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana]
4HLN_A	1.82e-81	2	471	126	623	Structureof barley starch synthase I in complex with maltooligosaccharide [Hordeum vulgare]
3D1J_A	7.58e-79	1	470	1	473	ChainA, Glycogen synthase [Escherichia coli]
2QZS_A	9.36e-79	1	470	1	473	CrystalStructure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSb) [Escherichia coli],2R4T_A Crystal Structure of Wild-type E.coli GS in Complex with ADP and Glucose(wtGSc) [Escherichia coli],2R4U_A Crystal Structure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSd) [Escherichia coli],3GUH_A Crystal Structure of Wild-type E.coli GS in complex with ADP and DGM [Escherichia coli K-12]
3COP_A	7.22e-78	1	470	1	473	ChainA, Glycogen synthase [Escherichia coli],3CX4_A Chain A, Glycogen synthase [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4IS20	3.09e-164	1	473	1	474	Glycogen synthase OS=Geobacillus thermodenitrificans (strain NG80-2) OX=420246 GN=glgA PE=3 SV=1
A0PY73	1.02e-163	1	473	1	475	Glycogen synthase OS=Clostridium novyi (strain NT) OX=386415 GN=glgA PE=3 SV=1
O08328	1.25e-163	1	473	1	474	Glycogen synthase OS=Geobacillus stearothermophilus OX=1422 GN=glgA PE=3 SV=1
Q97GX6	9.41e-159	1	473	1	476	Glycogen synthase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=glgA PE=3 SV=1
B7GK04	1.93e-157	1	473	1	474	Glycogen synthase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) OX=491915 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999813	0.000211	0.000010	0.000001	0.000000	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002685_00719.