CAZyme Information: MGYG000002685_02565

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales_A; UBA9506
• CAZyme ID: MGYG000002685_02565
• CAZy Family: GH88
• CAZyme Description: Unsaturated chondroitin disaccharide hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
167		18800.18	4.4167

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002685	3385444	MAG	Canada	North America

• Gene Location: Start: 131; End: 634 Strand: +

Full Sequence      

MPRNGSTAQGYSDQSCWSRGQAWGVYGFALAYAQTKQVKYLNCFKRAADYFISKLPEDTI
PYWDFTFTDGDEPRDSSAAVIAACGILEAAGLVSNDEKIDFYLEICEKMTKSLLDKYVIA
PESGIDGLISGGTAFKAQGQYDQALIFGDYFYMELLTRLTTDWKKYW

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	2	159	3.9e-55	0.48328267477203646

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	1.04e-07	2	142	173	314	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUH29908.1	1.46e-49	2	167	216	388
QUI24622.1	6.46e-48	2	167	217	389
SEU07984.1	1.37e-47	2	167	219	391
AWY99292.1	1.69e-47	2	167	214	386
BCS80130.1	2.47e-47	2	167	108	275

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WUX_A	3.61e-36	2	167	230	398	Crystalstructure of unsaturated glucuronyl hydrolase mutant D115N/K370S from Streptococcus agalactiae [Streptococcus agalactiae NEM316]
2ZZR_A	6.95e-36	2	167	229	397	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANI_A	7.06e-36	2	167	230	398	Crystalstructure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III],3ANK_A Crystal structure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae complexed with dGlcA-GalNAc6S [Streptococcus agalactiae serogroup III]
3ANJ_A	7.06e-36	2	167	230	398	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]
3VXD_A	7.06e-36	2	167	230	398	Crystalstructure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316],3VXD_B Crystal structure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316],3VXD_C Crystal structure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316],3VXD_D Crystal structure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8DR77	1.82e-36	1	167	227	396	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1
Q8E372	3.87e-35	2	167	230	398	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1
Q9A0T3	3.05e-33	2	167	231	399	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1
Q9RC92	5.05e-27	5	167	207	372	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1
T2KLZ3	1.08e-20	7	158	241	393	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000016	0.000043	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002685_02565.