CAZyme Information: MGYG000002687_01856

Basic Information

• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Desulfovibrio
• CAZyme ID: MGYG000002687_01856
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
536		58880.82	6.9412

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002687	2671909	MAG	Canada	North America

• Gene Location: Start: 5770; End: 7380 Strand: +

Full Sequence      

MRLDALVINLNRFGDLLLSQPLLHDLHKAGRSATLLCLEKYADTEGLLQFASPLLTVPDH
LASPEQADATRHELQAWAQDLRASVQADHIINLTPSMPARMLATALAPAPEAVLGFGLDH
KGRPRVDGLWAAFLHAAELRQSNAPFNLADMFRMTGAPLLGGLSGELLSQPGSGLLSELG
TEARKTARRLLAHAPVIRHGFIGMQLGASEKRRQWPVGHFVELGKRIWQEEGICPVLLGE
ASERPLADEYARLTSTPFVDVVGQTNIFELGAVLREMAMLVTNNTGTMHLAAGLGLPLLS
IFLATAQPCDTGPYLPGSCCLEPTLPCHPCPHDHDCVLGEKCRHHISASIVADLVLAKLT
SGQWSEGITTSACREARIWQTATDSRGFITTTCLSDHKADDRTLWLCQQRVYWRRILDDL
TSGATEPTPLTNVPLSMACPNYSSQFAARVGKALSHCAHLLQTLLQECAPLPERFDPTGH
PLCMTILQHMQSCPELASMAFFWHQLCQHYQGRGPRFLQAVRLLHAHILRWGRSFD

Enzyme Prediction     

No EC number prediction in MGYG000002687_01856.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	77	338	7.2e-39	0.9511111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03789	GT9_LPS_heptosyltransferase	2.92e-26	6	359	3	275	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
pfam01075	Glyco_transf_9	5.42e-12	171	330	79	236	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
COG0859	RfaF	5.68e-12	1	332	2	306	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
TIGR02195	heptsyl_trn_II	2.44e-08	213	359	189	329	lipopolysaccharide heptosyltransferase II. This family consists of examples of ADP-heptose:LPS heptosyltransferase II, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SFV73442.1	0.0	1	536	1	536
AMD90830.1	7.17e-152	1	534	1	543
QTO40658.1	2.60e-131	5	535	14	568
QCC86588.1	7.85e-129	5	535	23	574
SPD35034.1	3.99e-124	4	534	27	573

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P45042	5.01e-06	190	306	176	291	ADP-heptose--LPS heptosyltransferase 2 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=rfaF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002687_01856.