CAZyme Information: MGYG000002688_00403

Basic Information

• Species: Borkfalkia sp900557285
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; Borkfalkia; Borkfalkia sp900557285
• CAZyme ID: MGYG000002688_00403
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
763		85852.63	5.414

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002688	1832213	MAG	Canada	North America

• Gene Location: Start: 9002; End: 11293 Strand: -

Full Sequence      

MRFETTFKAATKEYSDYDTYVPAPYMRGTFCLKALPERAEITVTALGFYDLYINGVRLTK
GILAPYIGNPDQVVVYDRYDLNGYLCEGKNVVGLILGNGFTNNFGGRPWDIDKASFRAAP
KTAFCVEADGKVIFSSADSLKTAPSPILCDDYREGEVYDARKEIGGWNLPSFDDSAWSEA
ILADTPKGRRVLADFEPVREYKKRNAVAIVPLEDGYLYDFGVNTAGVPILKIDGKPGQKV
TLVCGEWFKNGNMDTKNIQCWVRARERDREIQKIEYTCKGEKGEGFTPCFSYYGCRYVKV
TGAEGSQITDDLIVFSEQSSALKKTGSFFCSDAYANKTFENTLRSDFSNFYYFPTDCPHR
EKAGWTGDAYLSAEQLILLLDCERSLRMWLSCIRDCQKESGAIPCIVPTAGWGYGWGSGP
SWDGVLTAVPYMLYRYTGKREILEENAEAIYKYLGFLRSIRKEDGTIAYGLGDWCQIGAL
RDSDPWTPNAVTDTMSALDICGKAAKIFDILGMTARAEEARVLKEEFRQAARAHFVEWRY
GDIYFCRPYCLTQTAQAVMLYRGVYEGEEIPHAALRMKEMLGGTENHMQVGVIGVQALLR
VLCENGMADLAYETAMSPDRPSYANMIDHGATSLWEFIHTFRKGTEYDVTVGKIKSMNHH
FWGDIAAWYITYIAGIRINEDLTDIYRVDISPYFVKPLNNAYAQHEMPYGKVIASWQRLS
EDKILLYAELPEGAHGVLKLHDGWKAEGDPVLCGGKKFVLTRG

Enzyme Prediction     

No EC number prediction in MGYG000002688_00403.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	214	740	8e-115	0.9861111111111112
CBM67	22	182	9e-25	0.8636363636363636

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	2.23e-65	323	673	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	5.44e-33	36	199	3	169	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	1.25e-18	216	312	8	96	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.02e-05	687	748	11	71	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGQ94103.1	1.34e-117	21	756	141	853
AVM44981.1	1.51e-117	22	743	49	744
ASU33388.1	3.55e-114	22	763	160	880
AHM58389.1	3.19e-113	22	740	178	880
ASZ12420.1	1.11e-112	22	738	158	858

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	5.36e-92	8	752	148	914	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	6.30e-61	37	725	317	980	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	5.88e-57	15	740	119	846	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
2OKX_A	5.46e-07	274	747	486	948	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	1.29e-66	23	758	184	921	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
P9WF03	1.73e-66	19	721	166	860	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KNB2	6.87e-64	25	725	176	864	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
Q82PP4	3.21e-60	37	725	317	980	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002688_00403.