CAZyme Information: MGYG000002691_00742

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; Dysosmobacter
• CAZyme ID: MGYG000002691_00742
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
554		59552.19	4.6689

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002691	2941528	MAG	Canada	North America

• Gene Location: Start: 81317; End: 82981 Strand: +

Full Sequence      

MKKLISGLLAVLMTAALAIPSAGAYSDIPAGSALSEEVWKAVDLGLMNGYSPDTFGYSDS
VTRAQFVTVVGRMLGWFDAGQPAQAYITPQMQVPQDIATTYWTAISAAAKYDAVDDTIPF
RPNDAITRGEMAEILVRALGLKGTAATAEKESSLPFQDVTSGKGYVAVAYAIGLTNGTSA
TTFSPSATATRAQAAAMLVRIYEKINQSSGFVHGFYALSSYSQLSSASGMDAVSAGWSRM
TWDGTTALLATTGANNNEYYVPTGYSEVTDYMQSHQVPLHLSVFMDTGSGLKELLASADG
RSQAIAQIVNEVTVTYQAIGRNPYSGVTIDFEGLRSGQKADFTAFIQALAKELDKLGKSL
YVCVSPALAGGSYYDGYDYRAIGDAADKVILMAYDYESRDASLYVGSCIRDNQTFAQSTQ
NAPLGQVFWSLMAITDDATGVRDPSKVLLGISSKNVAWKVDENDCLISAKPVYLSNDAVW
QYLQKALAGEAGTSMTEQYLIVSSDSGERYFIWREDPALTLRTAKLLGITGISIWRLGTM
PLYNGWSWKGLLHT

Enzyme Prediction     

No EC number prediction in MGYG000002691_00742.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	241	539	6.9e-26	0.7804054054054054

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02874	GH18_CFLE_spore_hydrolase	3.99e-21	229	538	25	303	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
COG3858	YaaH	8.25e-17	316	538	200	408	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
cd06549	GH18_trifunctional	5.07e-12	286	539	74	292	GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain.
pfam00704	Glyco_hydro_18	6.61e-10	263	535	48	302	Glycosyl hydrolases family 18.
cd00598	GH18_chitinase-like	5.39e-09	281	395	69	177	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAK99492.1	3.42e-202	1	552	21	569
QUO37985.1	6.91e-200	1	553	1	552
QNL45580.1	3.88e-185	10	548	7	546
QIB69198.1	3.46e-134	2	547	6	548
QAT42616.1	2.47e-131	25	547	34	548

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4Q6T_A	3.15e-07	324	538	114	325	Thecrystal structure of a class V chitininase from Pseudomonas fluorescens Pf-5 [Pseudomonas protegens Pf-5]
5JH8_A	8.50e-07	297	395	85	179	Crystalstructure of chitinase from Chromobacterium violaceum ATCC 12472 [Chromobacterium violaceum ATCC 12472]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P38535	7.07e-08	46	206	928	1085	Exoglucanase XynX OS=Acetivibrio thermocellus OX=1515 GN=xynX PE=3 SV=1
P38536	1.21e-06	46	204	1702	1857	Amylopullulanase OS=Thermoanaerobacterium thermosulfurigenes OX=33950 GN=amyB PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000394	0.998705	0.000198	0.000255	0.000221	0.000193

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002691_00742.