CAZyme Information: MGYG000002691_02694

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; Dysosmobacter
• CAZyme ID: MGYG000002691_02694
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
562		61488.59	4.0723

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002691	2941528	MAG	Canada	North America

• Gene Location: Start: 6353; End: 8041 Strand: -

Full Sequence      

MRKLHLPKQLLAGMLAGMLALMPAAAFTDTAGHWAEGAINKWSQEYSLIQGYEDGTFRPD
DSITRGAFAGIMDRFMKFQEISPAQTFSDTAGTYWESAILKLHAAGVYLGNDGKALPSDT
ITRQQAVTMIARAFDITGSDTAALPYGDEALIADYARGAVAEMSARGYITDSWNGDFRPT
DPITRAEIVNIFSNMVQTLIQDSGTHTGDVNGTVMINASGSVSLENMKISGDLILAPGVT
GPVTLTNVTIAGAIRNFSDVEPTLVSDETHTPETPEEPTTPEEPQTPEDPQTPVTPGIDP
TTVYTPGTKTGETIAYSGLQIPVYAERDRLELYPGEFYWEGDRLVYAGSAFDTRFGIDVS
AYQNRASANETIDWEAVANDGVDFAMVRIGLRGTSSGAILADAFYKQNIEGAMNAGIETG
VYFFAQAITVEEAIEEADFVIKLLEDYDIDGPVAYDWEMHDSSYRVYGTSPEMATACAIA
FCQRIEEAGYTPMIYAGQYVSYMKYDQGAISPYLSWYPEYKTTSSEKLYPTFFYQMNYWQ
FSSSCSIDGIGGKVDANIQFIR

Enzyme Prediction     

No EC number prediction in MGYG000002691_02694.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	357	550	2.6e-38	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06414	GH25_LytC-like	1.42e-65	354	560	1	191	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.
cd00599	GH25_muramidase	9.48e-27	356	558	2	185	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
pfam01183	Glyco_hydro_25	1.08e-17	357	550	1	180	Glycosyl hydrolases family 25.
cd06415	GH25_Cpl1-like	1.18e-16	356	558	3	193	Cpl-1 lysin (also known as Cpl-9 lysozyme / muramidase) is a bacterial cell wall endolysin encoded by the pneumococcal bacteriophage Cp-1, which cleaves the glycosidic N-acetylmuramoyl-(beta1,4)-N-acetylglucosamine bonds of the pneumococcal glycan chain, thus acting as an enzymatic antimicrobial agent (an enzybiotic) against streptococcal infections. Cpl-1 belongs to the CP family of lysozymes (CPL lysozymes) which includes the Cpl-7 lysin. Cpl-1 has a glycosyl hydrolase family 25 (GH25) catalytic domain with an irregular (beta/alpha)5-beta3 barrel and a C-terminal cell wall-anchoring module formed by six similar choline-binding repeats (ChBr's). The ChBr's facilitate the anchoring of Cpl-1 to the choline-containing teichoic acid of the pneumococcal cell wall. Other members of this domain family have an N-terminal CHAP (cysteine, histidine-dependent amidohydrolases/peptidases) domain similar to that of the firmicute CHAP lysins and associated with endopeptidase activity. The Cpl-7 lysin is also included here as is LysB of Lactococcus phage, and the Mur lysin of Lactobacillus phage.
cd06525	GH25_Lyc-like	7.30e-16	356	557	2	182	Lyc muramidase is an autolytic lysozyme (autolysin) from Clostridium acetobutylicum encoded by the lyc gene. Lyc has a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCK85948.1	3.46e-286	1	561	1	548
QUO37824.1	8.95e-265	16	560	17	556
QCI60549.1	3.65e-261	8	562	4	545
QNL45744.1	4.77e-203	10	561	9	543
BAK99312.1	1.99e-194	15	561	15	542

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4KRU_A	1.02e-07	356	557	22	205	X-raystructure of catalytic domain of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
4KRT_A	2.44e-07	356	557	22	205	X-raystructure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101],4KRT_B X-ray structure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P38536	4.93e-14	27	197	1682	1856	Amylopullulanase OS=Thermoanaerobacterium thermosulfurigenes OX=33950 GN=amyB PE=3 SV=2
P38535	6.77e-13	10	197	893	1082	Exoglucanase XynX OS=Acetivibrio thermocellus OX=1515 GN=xynX PE=3 SV=1
Q06852	7.02e-09	24	135	2142	2265	Cell surface glycoprotein 1 OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=olpB PE=3 SV=2
C6CRV0	3.05e-07	34	187	1291	1450	Endo-1,4-beta-xylanase A OS=Paenibacillus sp. (strain JDR-2) OX=324057 GN=xynA1 PE=1 SV=1
Q06853	5.61e-07	26	133	524	637	Cell surface glycoprotein 2 OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=Cthe_3079 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000388	0.998699	0.000251	0.000243	0.000192	0.000177

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002691_02694.