CAZyme Information: MGYG000002695_00494

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; UBA644
• CAZyme ID: MGYG000002695_00494
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
368	MGYG000002695_2|CGC5	40856.89	4.838

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002695	1947536	MAG	Canada	North America

• Gene Location: Start: 233497; End: 234603 Strand: +

Full Sequence      

MKVQFSSLIYDNPLPQLRSRQAAFPFLAELDDGTLLAAYQIGEAFESVDGTSYISTSTDG
GKTWSQPRNMFDKSHEVVPITDCCKVTSLGGGKLVGVGYEYDRTHPEWPIGNPETGGLID
DRVYITRSSDNGKTWSEHEAVPNHWGPHTEASAPITVLKNGDWITPITGFPDWSGKMSDR
LCGRLLRSSDEGKTWNDDTVCMEFEGDCVTCYEQRACQLQKSGAIVVIGWNENVKTGERL
NNHYTISYDNGKTFSKPMDTGIHGQASSVCAIGEDKLLALHAVRRDTDRPGIYGYIVDLA
DGTWKIEQELLIWEPATPVMRDTKAADIFAFLKFGQPGAILLKNGNIMMSHWFASDGQYK
TMATYIEL

Enzyme Prediction     

No EC number prediction in MGYG000002695_00494.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	23	286	2e-18	0.7543859649122807

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	2.07e-15	25	305	17	294	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
cd15482	Sialidase_non-viral	2.38e-09	30	200	153	298	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	2.98e-09	33	302	1	260	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
cd15482	Sialidase_non-viral	2.43e-08	31	293	86	334	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	0.002	30	197	119	253	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM08472.1	1.94e-163	1	368	1	372
QDU43468.1	6.18e-56	6	356	22	371
QDT47867.1	3.38e-55	6	356	22	371
QEE20297.1	2.21e-52	1	359	1	350
AKR55212.1	1.21e-51	9	359	9	350

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HX0_A	2.33e-06	22	357	58	389	ChainA, Uncharacterized protein Dfer_1899 [Dyadobacter fermentans DSM 18053],5HX0_B Chain B, Uncharacterized protein Dfer_1899 [Dyadobacter fermentans DSM 18053]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002695_00494.