CAZyme Information: MGYG000002695_00545

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; UBA644
• CAZyme ID: MGYG000002695_00545
• CAZy Family: GT51
• CAZyme Description: Penicillin-binding protein 1A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
231	MGYG000002695_3|CGC2	26651.12	4.3657

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002695	1947536	MAG	Canada	North America

• Gene Location: Start: 36584; End: 37279 Strand: +

Full Sequence      

MKKILKGIGLVLSGMLIILLILAGVTGIQGYQQYQQVIQQEPIEQKISQIQEDENYTEIE
EISEHFKQALIAVEDHRFYTHSGFDVLTTTRVMFENLFHMSLDAGGSTITQQLARNFYFT
QDKLFTRKVAELFVAFDIEEQYSKDEILELYMNIIYFGNNCYGIKEAAEFYYNKQPSELT
LEESTYLAGLPQAPSVYSQDDVKGQQRQKQVTDAMVKYHYLTQEEADEITG

Enzyme Prediction     

No EC number prediction in MGYG000002695_00545.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	47	215	7.1e-61	0.9661016949152542

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00912	Transgly	1.21e-73	56	216	15	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02074	PBP_1a_fam	2.29e-66	56	228	4	178	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG5009	MrcA	4.81e-65	56	228	69	243	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
COG0744	MrcB	9.73e-65	47	228	69	253	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
PRK13481	PRK13481	3.25e-44	50	228	41	227	glycosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZV41456.1	5.83e-59	42	218	39	217
BBK21420.1	1.06e-56	37	225	33	223
QHS24352.1	2.44e-56	38	218	35	215
BBK61494.1	4.27e-56	37	225	33	223
QUO38940.1	1.37e-55	38	226	38	228

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5ZZK_A	2.08e-34	46	198	49	207	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]
3HZS_A	2.26e-34	46	198	13	171	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus MW2]
6FTB_A	2.33e-34	46	198	14	172	Staphylococcusaureus monofunctional glycosyltransferase in complex with moenomycin [Staphylococcus aureus MW2]
3NB6_A	2.51e-34	56	228	22	196	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
3VMQ_A	3.13e-34	46	198	66	224	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50],3VMQ_B Chain B, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50],3VMR_A Chain A, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50],3VMS_A Chain A, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50],3VMS_B Chain B, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50],3VMT_A Chain A, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50],3VMT_B Chain B, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O87579	2.21e-37	56	228	70	244	Penicillin-binding protein 1A OS=Neisseria lactamica OX=486 GN=mrcA PE=3 SV=1
Q5FAC7	4.12e-37	56	228	70	244	Penicillin-binding protein 1A OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) OX=242231 GN=mrcA PE=3 SV=3
P0A0Z6	4.12e-37	56	228	70	244	Penicillin-binding protein 1A OS=Neisseria meningitidis serogroup B (strain MC58) OX=122586 GN=mrcA PE=3 SV=1
P0A0Z5	4.12e-37	56	228	70	244	Penicillin-binding protein 1A OS=Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491) OX=122587 GN=mrcA PE=3 SV=1
O05131	4.12e-37	56	228	70	244	Penicillin-binding protein 1A OS=Neisseria gonorrhoeae OX=485 GN=mrcA PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.825188	0.164231	0.005877	0.000587	0.000403	0.003731

TMHMM  Annotations     

start	end
7	29