CAZyme Information: MGYG000002699_00301

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74; HGM11588
• CAZyme ID: MGYG000002699_00301
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
847		93850.26	5.2212

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002699	3362623	MAG	Canada	North America

• Gene Location: Start: 81722; End: 84265 Strand: +

Full Sequence      

MIQAHFIRLEYGRTSPGTIAIVETPAPMISWAISGESQAAWRIRVGCRGEMLWDSQWVRS
ASQCAAYAGKALTPGDVNELSLEVMDESGAVSAAACVRFCLGALGEWKAPWIGEAEAGED
TVPCFSKTFFCRRPVEDACLFASGIAYQRITLNGAQIDGSFMNPALSEYEKRCYYAVYPG
LALREGENRIGIEVAAGWRSPHNVCYKLTGRVPDFTGPTLLSAALRIRYRDGGEEWLYTD
ESWKCRYGAIVYSNIFMGETYDAAKALPHFAAPGDNDSSAPCARVFPAPCEKMCVQALEP
VRAHEEYPAVSVMEVKPGVFVADFGQNIAGLCRLRLPRTLAAGQEIRMAHMEMLDEDGTL
YTPPLRNAACTDRYIALGDGKDAAFWQPQFTYHGFRYAQVEGLGQPLRKEDICAVSLYSD
VDSHSSFRCGSAIVNAIQKMVVQTERANIHSILTDCPQRDERMGWMNDATVRFEETPYNF
DIGRLFPKVVRDLLDVQDESGAICCTAPFAFGCRPADPVCSSFLVAGWQAYMHTGNLDIL
REGYSGFKAWNDCLAAHSQQGIVNYSYYGDWAGPAYACEGEDGAKSSETPGILMSTGYHY
FNARLLARMAAALGQEDEAAEQNARADAIREAFLAKWWDEASGKVATGSQACQAFALWLG
ILPEEGRAKAAKVLHDDLAAREYRFTTGNLCTRYMMDALTQWGYLEDAWTLITREAYPSW
GFMLQNEATTVWERFELKKNPGMNSHNHPMYAAVGYWFYAYLAGVKPLEAGWKRVAIHPY
MPKNLLSAQATVETPLGDVSVRWVKRYGQAHLYVQIPCGAQADVTLPQGTQSVSAGFHHF
SWPLDAE

Enzyme Prediction     

No EC number prediction in MGYG000002699_00301.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	313	826	9.7e-145	0.996031746031746
CBM67	110	285	2.8e-20	0.9375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	3.92e-79	425	762	4	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam05592	Bac_rhamnosid	2.45e-33	314	418	2	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	5.82e-32	134	305	2	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam17390	Bac_rhamnosid_C	2.59e-15	764	841	1	78	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA22854.1	4.17e-180	7	827	37	852
VEH16339.1	4.62e-172	26	827	51	854
QEC51112.1	5.74e-165	7	827	74	896
AEF82974.1	2.67e-157	27	827	31	842
AHF90970.1	1.58e-147	22	831	22	849

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	1.45e-134	22	828	46	900	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	5.96e-99	133	827	314	995	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	2.36e-81	125	836	134	857	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KNB2	2.15e-100	27	827	55	879	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
Q82PP4	2.64e-98	133	827	314	995	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
P9WF03	1.48e-86	26	835	50	887	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KPL4	2.23e-79	22	828	46	908	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000008	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002699_00301.