CAZyme Information: MGYG000002699_01122

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74; HGM11588
• CAZyme ID: MGYG000002699_01122
• CAZy Family: GT35
• CAZyme Description: Glycogen phosphorylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
742	MGYG000002699_17|CGC2	83229.56	5.4582

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002699	3362623	MAG	Canada	North America

• Gene Location: Start: 43821; End: 46049 Strand: +

Full Sequence      

MLETLSRLAGKPLASCTNAEIYAALQALVREKAQERPLCTGNRRLYYISAEFLLGKLLSC
NLINLGLRAEVAAALASVGKSLAEIEECECEPSLGNGGLGRLAACFLDSIATLGLPGDGV
GLNYHFGLFRQRFEEEKQREYPNPWMDGACWLEDTGVSFTVPYDGFALTSRMYDIAVTGY
GAGANRLHLFDLTTVDESIVKDGIDFDKSDIAHNLTLFLYPDDSDRAGQLLRIYQQYFMV
SNAAQLILKETRERGFSLRDLHRHVAVQINDTHPSLVIPELIRLLTAEGIELDEAIDIVS
HTCAYTNHTILAEALETWPMDYLKEAVPHLVPIIETLDARAKAAHPDPRVAIIDAQQRVH
MAHMDIHYGFSVNGVAALHTRILETSELAPFYAIYPGKFNNKTNGITFRRWLMACNPALS
AWITSLIGEGWKQNADELEKLLAYQEDAAARETMLAIKAENKRSLARTLGLDADSLFDVQ
IKRLHEYKRQQMNALYAIYQYLQIKAGKLPRRPITMLFGAKAAPAYILAKDIIHLILCLA
RLFREDEQVRPWLNITMVENYNVSWAERLIPACDLSEQISLASKEASGTGNMKFMLNGAV
TLGTMDGANVEISDLVGRENIYIFGKSSEEVIRLYATGGYHSREIYEGDPLAEELVDFIL
SKPLLRIGDPVCLARLYKDLICKDWFMTLLDLREYIAAKERALNDYEERDAWAKKMLVNT
AKAGFFSSDRTIAQYNAGIWKL

Enzyme Prediction     

EC	2.4.1.1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT35	74	742	1.3e-210	0.9970326409495549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK14986	PRK14986	0.0	18	740	43	808	glycogen phosphorylase; Provisional
COG0058	GlgP	0.0	2	742	14	748	Glucan phosphorylase [Carbohydrate transport and metabolism].
PRK14985	PRK14985	0.0	23	741	40	795	maltodextrin phosphorylase; Provisional
TIGR02093	P_ylase	0.0	1	742	1	794	glycogen/starch/alpha-glucan phosphorylases. This family consists of phosphorylases. Members use phosphate to break alpha 1,4 linkages between pairs of glucose residues at the end of long glucose polymers, releasing alpha-D-glucose 1-phosphate. The nomenclature convention is to preface the name according to the natural substrate, as in glycogen phosphorylase, starch phosphorylase, maltodextrin phosphorylase, etc. Name differences among these substrates reflect differences in patterns of branching with alpha 1,6 linkages. Members include allosterically regulated and unregulated forms. A related family, TIGR02094, contains examples known to act well on particularly small alpha 1,4 glucans, as may be found after import from exogenous sources. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
cd04300	GT35_Glycogen_Phosphorylase	0.0	1	742	4	795	glycogen phosphorylase and similar proteins. This is a family of oligosaccharide phosphorylases. It includes yeast and mammalian glycogen phosphorylases, plant starch/glucan phosphorylase, as well as the maltodextrin phosphorylases of bacteria. The members of this family catalyze the breakdown of oligosaccharides into glucose-1-phosphate units. They are important allosteric enzymes in carbohydrate metabolism. The allosteric control mechanisms of yeast and mammalian members of this family are different from that of bacterial members. The members of this family belong to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQR28931.1	0.0	3	742	5	756
ANU53686.1	0.0	3	742	5	756
ASB39637.1	0.0	3	742	5	756
QEK18432.1	0.0	10	740	12	748
QHB23533.1	0.0	3	742	7	753

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4L22_A	2.24e-312	10	740	17	755	Crystalstructure of putative glycogen phosphorylase from Streptococcus mutans [Streptococcus mutans UA159]
2C4M_A	3.67e-168	9	742	21	788	Starchphosphorylase: structural studies explain oxyanion-dependent kinetic stability and regulatory control. [Corynebacterium callunae],2C4M_B Starch phosphorylase: structural studies explain oxyanion-dependent kinetic stability and regulatory control. [Corynebacterium callunae],2C4M_C Starch phosphorylase: structural studies explain oxyanion-dependent kinetic stability and regulatory control. [Corynebacterium callunae],2C4M_D Starch phosphorylase: structural studies explain oxyanion-dependent kinetic stability and regulatory control. [Corynebacterium callunae]
7TM7_A	1.91e-160	17	741	39	801	ChainA, Alpha-1,4 glucan phosphorylase [Klebsiella pneumoniae subsp. pneumoniae HS11286],7TM7_B Chain B, Alpha-1,4 glucan phosphorylase [Klebsiella pneumoniae subsp. pneumoniae HS11286]
5OX0_A	8.21e-160	17	740	48	826	GlycogenPhosphorylase in complex with CK898 [Oryctolagus cuniculus]
2GJ4_A	9.51e-160	17	740	36	814	Structureof rabbit muscle glycogen phosphorylase in complex with ligand [Oryctolagus cuniculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P29849	0.0	10	742	13	751	Maltodextrin phosphorylase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=malP PE=3 SV=2
P39123	2.80e-174	2	740	13	792	Glycogen phosphorylase OS=Bacillus subtilis (strain 168) OX=224308 GN=glgP PE=2 SV=1
P73511	2.20e-161	1	742	33	826	Glycogen phosphorylase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=glgP PE=3 SV=1
P00489	8.92e-159	17	740	48	826	Glycogen phosphorylase, muscle form OS=Oryctolagus cuniculus OX=9986 GN=PYGM PE=1 SV=3
Q9WUB3	2.43e-158	17	740	48	826	Glycogen phosphorylase, muscle form OS=Mus musculus OX=10090 GN=Pygm PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002699_01122.