CAZyme Information: MGYG000002699_01858

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74; HGM11588
• CAZyme ID: MGYG000002699_01858
• CAZy Family: GH163
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
596	MGYG000002699_37|CGC1	67819.16	6.5613

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002699	3362623	MAG	Canada	North America

• Gene Location: Start: 9264; End: 11054 Strand: +

Full Sequence      

MKTHLLAEHGKTAWRIVMAHPAHETVKLACDELFHFVMQMSGAALPVQTELVADGEYEIL
VGNSGRLAHHGIHVDWDELGEEGFVMQSAEHYLLLAGATPRGTLYAVYAFLEEELGCRWF
ASDCARIPKKAVLAFSQVSRVEKPAFESREAYWRDAFDGAFAVRNRMNSNKADISIRQGG
RMKFYNFHHSFNDLLSPGEYFDQHPEYFSLVNGVRLRDRTQLCLTNPEVLQIAIARVRQW
IRENPDCRVFSVAQNDWGNYCTCPACAALDAREGSPAGTMIAFVNQVAEAIHEEYPHIYL
HTFAYQYTRKAPRTIRPHPNVIVRLCSIECCFSHPLDGTHAAPLAPQEKQPRGVQCGGPD
SNAFLRDLREWSAICNHLYIWDYTTQFHNYLQPMPNFDALCRNLRLFRDMGVKGVLEQGN
FSHGGGGHLAELEAYLQAKLLWNPDCDMQAHMMDFLNGYYGEAAAPLVFAYIEGWQQAVR
PWHMRIYDSAHAPYITEELLEKSVNLLGEALRLTSGARQRARLSRLCASMDFLLISRLPL
GTPGRNAMIDRFGWALREAGIDEIHERWTLEDALAQMKAADDERMQKRSLTNDYKM

Enzyme Prediction     

No EC number prediction in MGYG000002699_01858.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH163	195	471	5.6e-89	0.9880478087649402

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16126	DUF4838	3.17e-107	187	472	1	263	Domain of unknown function (DUF4838). This family consists of several uncharacterized proteins found in various Bacteroides and Chloroflexus species. The function of this family is unknown.
pfam03648	Glyco_hydro_67N	3.00e-06	15	109	23	119	Glycosyl hydrolase family 67 N-terminus. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the N-terminal region of alpha-glucuronidase. The N-terminal domain forms a two-layer sandwich, each layer being formed by a beta sheet of five strands. A further two helices form part of the interface with the central, catalytic, module (pfam07488).
cd14791	GH36	0.004	201	300	97	194	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIF26900.1	0.0	1	596	1	600
ASV73444.1	2.74e-140	5	540	27	549
QOY90686.1	1.18e-120	6	467	19	463
QQL44163.1	4.25e-120	6	473	12	464
AIE83908.1	1.39e-108	29	522	36	501

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002699_01858.