CAZyme Information: MGYG000002699_02171

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74; HGM11588
• CAZyme ID: MGYG000002699_02171
• CAZy Family: GH95
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
719	MGYG000002699_48|CGC1	80124.76	5.347

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002699	3362623	MAG	Canada	North America

• Gene Location: Start: 17042; End: 19201 Strand: -

Full Sequence      

MKASAVWTHAPASWPGELWRESLPLGNGCTAALLCGSAGCEHLWIQRFDRWEGGEEGELP
DVHDTLGEARALIAQGQCARANGLLAGALAARGYAPRLATPMAPLEIRIRMETSAPFSQY
ARGVDLDTGEAFVTFTQGEARVERRCFVSRAEDLVLLRMRAEGGTLSGRIDLPEGEELRI
RVFLPAGGLLRAEGACCWRFEAAEELLLVAKFGEIPPEAPRYEELLAQHIPLHRMAMGNA
QLTLGNEGRATDDLLAEAARDAAPVELAEKLWRFGRYLFASGTAEGGYPFALYGLWNGVA
HAPWAQNVANENVQMIYWHALAGGFEALLRPLIDYYYRKMDAFREAARKLFGCRGIFVSV
YTTPENSLPAPNVPVIVNYTGAAGWLCRHFYAYYQYTGDRALMQEKILPFMLETAAFYED
YLTRDARGRIQIVPSVSPENTPANFMPADFQEHMGHQNPVVWNSTMDFAIVRELLTHLVE
ASRDFVLDEARVAAWQGILRDMPPYMVNEDGALREWMDADLKDFYLHRHLSHLYPLFPGD
EIRPSDPLFEACARAVQLRKLDGLSGWSFSHMAAIYARLGQAEAAIACLDGLAKGCLLSN
LFTLHNDWRDMGVTLRISMAPVQLDALMGAVNAIQEMLLFAVPGEIRLLPACPLRFAQGS
VENWRVPEGIICFAWNRAEGWLRASLTARADCALTLRFPAWSGLAAREIRLRANETWNL

Enzyme Prediction     

No EC number prediction in MGYG000002699_02171.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH95	221	698	2.8e-118	0.6301939058171745

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14498	Glyco_hyd_65N_2	3.76e-19	15	196	6	183	Glycosyl hydrolase family 65, N-terminal domain. This domain represents a domain found to the N-terminus of the glycosyl hydrolase 65 family catalytic domain.
pfam03632	Glyco_hydro_65m	1.06e-07	330	545	55	279	Glycosyl hydrolase family 65 central catalytic domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. The central domain is the catalytic domain, which binds a phosphate ion that is proximal the the highly conserved Glu. The arrangement of the phosphate and the glutamate is thought to cause nucleophilic attack on the anomeric carbon atom. The catalytic domain also forms the majority of the dimerization interface.
COG1554	ATH1	5.55e-06	315	502	351	548	Trehalose and maltose hydrolase (possible phosphorylase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANY73534.1	6.81e-199	11	703	12	788
AFC28111.1	2.72e-194	11	708	112	871
AFH60279.2	3.83e-194	11	708	112	871
AEI42327.1	2.15e-193	11	708	112	871
QKS45791.1	3.12e-193	11	700	16	759

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7KMQ_A	7.92e-47	2	669	39	730	ChainA, Glyco_hyd_65N_2 domain-containing protein [Xanthomonas citri pv. citri str. 306],7KMQ_B Chain B, Glyco_hyd_65N_2 domain-containing protein [Xanthomonas citri pv. citri str. 306]
2RDY_A	4.91e-43	14	676	9	733	ChainA, BH0842 protein [Halalkalibacterium halodurans C-125],2RDY_B Chain B, BH0842 protein [Halalkalibacterium halodurans C-125]
4UFC_A	6.88e-43	13	663	27	708	Crystalstructure of the GH95 enzyme BACOVA_03438 [Bacteroides ovatus],4UFC_B Crystal structure of the GH95 enzyme BACOVA_03438 [Bacteroides ovatus]
2EAB_A	2.40e-25	19	663	47	816	Crystalstructure of 1,2-a-L-fucosidase from Bifidobacterium bifidum (apo form) [Bifidobacterium bifidum],2EAB_B Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum (apo form) [Bifidobacterium bifidum],2EAC_A Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum in complex with deoxyfuconojirimycin [Bifidobacterium bifidum],2EAC_B Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum in complex with deoxyfuconojirimycin [Bifidobacterium bifidum]
2EAD_A	1.28e-24	19	663	47	816	ChainA, Alpha-fucosidase [Bifidobacterium bifidum],2EAD_B Chain B, Alpha-fucosidase [Bifidobacterium bifidum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8L7W8	9.55e-48	15	670	59	786	Alpha-L-fucosidase 2 OS=Arabidopsis thaliana OX=3702 GN=FUC95A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000005	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002699_02171.