CAZyme Information: MGYG000002699_02459

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74; HGM11588
• CAZyme ID: MGYG000002699_02459
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
365	MGYG000002699_63|CGC1	42411.09	5.8779

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002699	3362623	MAG	Canada	North America

• Gene Location: Start: 15264; End: 16361 Strand: -

Full Sequence      

MGKYKVCVYAICKNEAKFARRWMESMREADWVCALDTGSTDGTPELLERLGAIVAEKTID
PWRFDVARNEAMKLIPPQADICVSTDLDEAFTPGWREALEAAWTDDATQARYRYTWNFLP
DGSEGVVFWPDKIHRNGGFVWKHPVHEILSYQGPLPQKTVTCEGVQLNHRADREKSRGQY
LPLLELSVREDPDDDRNMHYLGREYFFYGRWKDCVETLKRHLALPRATWADERCASMRYI
AMALEHLGEMEEAERWFYRAVGEAPYLREPWVNLARFLYQRQDWPGVAYMTHRALQIQTR
PGSYINAAEAWGPLPWDLASIALYHLGQYKESARMAQEALRLAPGDERIRENLRLIRAQM
EEGAS

Enzyme Prediction     

No EC number prediction in MGYG000002699_02459.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02511	Beta4Glucosyltransferase	1.09e-13	5	213	1	221	UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.
pfam00535	Glycos_transf_2	1.18e-07	7	146	1	150	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
COG0463	WcaA	5.43e-07	3	259	2	254	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
sd00006	TPR	2.48e-06	198	284	4	85	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
sd00006	TPR	2.53e-06	237	341	4	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANU42689.1	1.55e-167	5	353	2	351
QQR04409.1	1.55e-167	5	353	2	351
QIA29496.1	8.94e-167	5	353	2	351
AQS58819.1	1.64e-148	1	361	1	361
AQS58818.1	4.11e-146	1	365	1	365

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000032	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002699_02459.