CAZyme Information: MGYG000002699_02958

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74; HGM11588
• CAZyme ID: MGYG000002699_02958
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
356		39897.53	4.7373

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002699	3362623	MAG	Canada	North America

• Gene Location: Start: 128; End: 1198 Strand: -

Full Sequence      

MKDHIVASFGPNAEYTRHSEGAFLRLKDGRILHIYSRFTGTDADDAPSDLVSLYSSDEGE
TWTEAVTTVSASRFGVQNVMSVSLMRMANDDVGLFFIVKEDNSAISHIWLARSNDEAASW
YKYTQCTLNDRQGYYVLNNDRIERLASGRLLMPMAFHRGGYRSESDSYFFGLGEVCFLYS
DDDGETWAESPDTICKPFNGTGTGLQEPGVIELRDGLLWAYARTDKMFQYESFSFDGGLH
WTVAQPSRFTSPESPMKIARNPANGDIVAVWNPIPNYNGRVRTRAGWGRTPIVYAISKDN
GATWGEQRVIEDDPDCGYCYPSVFFTNDGAMLVSYCAGGPDDHICLARLTMKKLYL

Enzyme Prediction     

No EC number prediction in MGYG000002699_02958.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	23	335	5.1e-30	0.8742690058479532

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	1.12e-44	22	350	18	339	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	1.28e-22	38	329	8	276	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
cd15482	Sialidase_non-viral	0.001	10	142	191	318	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM08403.1	2.68e-130	14	354	23	364
AOH43019.1	1.30e-85	17	356	21	358
AEL26177.1	9.34e-79	6	356	30	366
AKP51796.1	4.56e-78	6	354	37	373
AHF14608.1	5.70e-75	4	356	45	382

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1SLI_A	2.25e-07	106	335	426	648	LeechIntramolecular Trans-Sialidase Complexed With Dana [Macrobdella decora],1SLL_A Sialidase L From Leech Macrobdella Decora [Macrobdella decora],2SLI_A Leech Intramolecular Trans-Sialidase Complexed With 2,7- Anhydro-Neu5ac, The Reaction Product [Macrobdella decora],3SLI_A Leech Intramolecular Trans-Sialidase Complexed With 2,7- Anhydro-Neu5ac Prepared By Soaking With 3'-Sialyllactose [Macrobdella decora],4SLI_A Leech Intramolecular Trans-Sialidase Complexed With 2- Propenyl-Neu5ac, An Inactive Substrate Analogue [Macrobdella decora]
4X6K_A	2.46e-06	106	335	233	455	Crystalstructure of the intramolecular trans-sialidase from Ruminococcus gnavus in complex with Siastatin B [[Ruminococcus] gnavus CC55_001C]
4X47_A	2.47e-06	106	335	236	458	Crystalstructure of the intramolecular trans-sialidase from Ruminococcus gnavus in complex with Neu5Ac2en [[Ruminococcus] gnavus ATCC 29149],4X49_A Crystal structure of the intramolecular trans-sialidase from Ruminococcus gnavus in complex with oseltamivir carboxylate [[Ruminococcus] gnavus ATCC 29149],4X4A_A Crystal structure of the intramolecular trans-sialidase from Ruminococcus gnavus in complex with 2,7-Anhydro-Neu5Ac [[Ruminococcus] gnavus ATCC 29149]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q27701	1.28e-06	106	335	506	728	Anhydrosialidase OS=Macrobdella decora OX=6405 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002699_02958.